SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000003593 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000003593
Domain Number 1 Region: 240-439
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 6.67e-91
Family N-myristoyl transferase, NMT 0.0000000278
Further Details:      
 
Domain Number 2 Region: 59-239
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 8.19e-79
Family N-myristoyl transferase, NMT 0.000000344
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000003593   Gene: ENSCPOG00000003982   Transcript: ENSCPOT00000004026
Sequence length 440
Comment pep:known_by_projection scaffold:cavPor3:scaffold_141:75760:98123:-1 gene:ENSCPOG00000003982 transcript:ENSCPOT00000004026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PNSGGTKSDSASDSQEIKIHQPSKNATIPMQKLQDIQRAVELLSACQGPARNIDEAAKRR
YQFWDTQPVPKLNEVITSHGAIEPDKDNVRQEPYSLPQGFMWDTLDLSNTEVLKELYTLL
NENYVEDDDNMFRFDYSPEFLLWALRPPGWLLQWHCGVRVSSNKKLVGFISAIPANIRIY
DSVKRMVEINFLCVHKKLRSKRVAPVLIREITRRVNLEGIFQAVYTAGVVLPKPVATCRY
WHRSLNPRKLVEVKFSHLSRNMTLQRTMKLYRLPDVTKTSGLRPMQPKDIGAVRDLINSY
LKQFHLAPVMDEEEVAHWFLPREHIIDTFVVESSTGKLTDFLSFYTLPSTVMHHPAHKTL
KAAYSFYNIHTETPLLDLMNDALIIAKLKGFDVFNALDLMENKTFLEKLKFGIGDGNLQY
YLYNWRCPGTDSEKVGLVLQ
Download sequence
Identical sequences ENSCPOP00000003593 10141.ENSCPOP00000003593 ENSCPOP00000003593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]