SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000003737 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000003737
Domain Number 1 Region: 22-108
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0000000000507
Family Extracellular domain of cell surface receptors 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000003737   Gene: ENSCPOG00000004143   Transcript: ENSCPOT00000004188
Sequence length 141
Comment pep:known_by_projection scaffold:cavPor3:scaffold_3:54188241:54215963:1 gene:ENSCPOG00000004143 transcript:ENSCPOT00000004188 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWVLGIAATFCGLFLLPGFALQIQCYQCEEFQLNNDCSSPEFIVNCTVNVQDMCQKEVME
QSAGIMYRKSCASSAACLIASAGYQSFCSPGKLNSVCISCCNTPLCNGPRPKKRGSFASA
LRPTFPTTILLLKLALFLAHC
Download sequence
Identical sequences A0A286XFW2
XP_003478777.1.53824 ENSCPOP00000003737 10141.ENSCPOP00000003737 ENSCPOP00000003737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]