SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000003791 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000003791
Domain Number 1 Region: 250-318
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000013
Family Laminin-type module 0.038
Further Details:      
 
Domain Number 2 Region: 379-428
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000809
Family Laminin-type module 0.0065
Further Details:      
 
Domain Number 3 Region: 431-478
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000001
Family Laminin-type module 0.0065
Further Details:      
 
Domain Number 4 Region: 316-368
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000377
Family Laminin-type module 0.036
Further Details:      
 
Domain Number 5 Region: 537-584
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000112
Family Laminin-type module 0.023
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000003791
Domain Number - Region: 481-515
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000109
Family Laminin-type module 0.036
Further Details:      
 
Domain Number - Region: 76-151
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000276
Family N-terminal domain of xrcc1 0.058
Further Details:      
 
Domain Number - Region: 957-1162
Classification Level Classification E-value
Superfamily Tropomyosin 0.017
Family Tropomyosin 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000003791   Gene: ENSCPOG00000004205   Transcript: ENSCPOT00000004250
Sequence length 1175
Comment pep:known_by_projection scaffold:cavPor3:scaffold_12:13524775:13566480:1 gene:ENSCPOG00000004205 transcript:ENSCPOT00000004250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAVLLLFFALPGFLHAQNACSRGACYPPVGDLLIGRTQFLQASSTCGLTKPETYCTQYG
EWQMKCCKCDSRLPHNYNSHRVENVASSSGPTRWWQSQNDVSPVSLQLDLDRRFQLQGIT
MDFKGPVPAGMLIERSSDFGRTWRVYQYLADDCTSTFPRVHQGQPRNWQDARCQALPQRT
NGHLNGGKVQLNLMDLASGIPATRSQKIQELGDITNLRVNFTKLAPVPRKGRYPPSTYIA
VSQLRLQGTCFCHGHADRCAPKPGATAAGPSTVQVHDICVCQHNTAGPHCERCAPFYNNQ
PWRPAEDQDPHECQRCDCNGHSETCHFDPAVFAASQGAHGGVCDNCRDHTEGKNCERCQL
HYFRNRRPGAPLEETCIPCECDPDGAVPGAPCDPVTGQCVCKEHVQGERCDLCKPGFTGL
THTNPQGCHRCDCSILGARRDMPCDEETGRCLCLPNVVGPRCDQCAPNHWKLASGQGCQP
CACDPRTSLSSQCNQFTGQCPCQEGFDGLTCNAAAAIRQCPDQTHGDIATGCRSLACDCD
FRGTENPGCDKVSGRCLCRPGFTGRRCDQCQRGYCDSYPVCVACHSCFQTYDSGLKEQAG
RLSRLHNATAGLQLRPGLEDVGLASRILDAKSKMEQIQAILGSTSVTEQDMAQVANSIFS
IRRTLQGLQQDVPLEEEILSLPGDLEGLGRSFNNLLITYQNKRTEFEKISSADPAGAFQM
LTEAYERSSQASRQVSDSSHSLSLLRDSRKEAEGLMRQMQGGGAAGAPELAALRAEMASL
PDLTSTINKVCGGSRQAPCTPGACPGELCPQDNGTTCGSHCRGALPSTGGALQMAGQVAK
QLQGFSSQLQQTRQMIQAAEEAALQVQSDAQRLETQVSTSRSQMEDDVRRTRLLIQQVRD
FLTDPSTDAAIIEEVSKAVLALWLPTDSATVLRKMKEIQAIATRLPNVDLVLTQTKQDIA
RARRLQAEAEQARIRAHSVEGQVEDVVGNLRQGAVALQEARDTMRGTGRSLRLIQDRVAE
VQQVLGPAEGLVMRMTEQLGGFQARMEALRHQAQQQRAQAAQAQQLAEGASQRALSAQEG
FERIKQKYAELKDRLGRSPTLGEQGSRIHSVKTEAEELFGETMEMMDRMRDMESELLRGS
QAILLRSADLTGLEKRVEQIRDHINGRVLYYATCK
Download sequence
Identical sequences ENSCPOP00000003791 ENSCPOP00000003791 10141.ENSCPOP00000003791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]