SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000003827 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000003827
Domain Number 1 Region: 40-176
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.55e-42
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00066
Further Details:      
 
Domain Number 2 Region: 150-336
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.29e-38
Family Laminin G-like module 0.005
Further Details:      
 
Domain Number 3 Region: 351-519
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.62e-36
Family Laminin G-like module 0.0059
Further Details:      
 
Domain Number 4 Region: 783-959
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.07e-34
Family Laminin G-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 966-1142
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.98e-24
Family Laminin G-like module 0.0085
Further Details:      
 
Domain Number 6 Region: 576-635
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.000000157
Family Fibrinogen C-terminal domain-like 0.0056
Further Details:      
 
Domain Number 7 Region: 548-584
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000112
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000003827   Gene: ENSCPOG00000004241   Transcript: ENSCPOT00000004286
Sequence length 1144
Comment pep:known_by_projection scaffold:cavPor3:scaffold_3:64950231:65672049:1 gene:ENSCPOG00000004241 transcript:ENSCPOT00000004286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSLLGLPGVWTLLFSGFWHLGLTATTYTCDDPLASLLSPMAFSSSSDPTGTPSPAQLNW
KVGTGGWSPADSNAQQWLQMDLGNRVEITAVATQGRYGSSDWVTSYSLMFSDTGRNWKQY
KQEDSIWTFAGNMNADSVVHHKLLHSVRARFVRFVPLEWNPSGKIGMRVEVYGCSYKSDV
ADFDGRSSLLYRFNQKLMSTLKDVISLKFKSLQGDGVLFHGEGQRGDHITLELQKGRLTL
YLNLEDSKARLSSSPPSAILGSLLDDQHWHSVLIERVGKQVNFTVDKHTQHFRAKGEADA
LDIDYELSFGGIPVPGKPGTFLKKNFHGCLENLYYNGVNIIDLAKRRKHQIYTGNVTFSC
SEPQIVPITFVNSSSSYLLLPGTPQIDGLSVSFQFRTWNKDGLLLSTKLSEGSGALLLSL
EGGILRLVIQKMTEHTAEILTGSSLNDGLWHSVSINARRNRITLTLDNEAASPAQDTTSV
QIYSGSNYYFGGCPDNLTDPQCLNPIKAFQGCMRRIFIDNQPKDLISVQQGSLGNFSDLH
IDLCSIKDRCLPNYCEHEGRCSQSWTTFYCNCSDTGYTGATCHNSIYEQSCEVYRHRGNT
AGFFYVDSDGSGPLRPLRVYCNITEDKIWMSVQHNNTELTRVHDASPQKPYTMTLDYGSS
LEQLEALIDDSEHCEQEVAYHCKRSRLLNTPDGAPFTWWIGRANEKHPYWGGSLPGVQQC
ECGLEESCLDIRHFCNCDADKDEWTNDTGFLSFKDHLPVTQIVITDTNRSNSEAAWRIGP
LRCYGDRHFWNAVSFYTEASYLHFPTFHAEFSADISFFFKTTALSGVFLENLGIKDFIRL
EISSPSEITFAIDVGNGPVELVVRSLSPLNDNQWHYVRAERSLKETSLQVDSLPRSTRET
SEEGHFRLQLNSQLFVGGTSSRQKGFLGCIRSLLLNGQKVDLEERAKVTSGVRPGCPGHC
SSYGSNCHNGGKCVEKHSGYACDCTHSPYEGPFCQKEISAVFEASTSVTYMFQEPYPVTK
NTSLSSSAIYTDMAPSKENIALSFVTAQAPSLLLFLNSSSQDFLAVLLCKNGSLQVRYQL
SKEQTHVFTIDVENFANRRMHHLQINREGRELTIQMDQQLRLNYNFSPEVEFRTVRSLIL
GRIT
Download sequence
Identical sequences ENSCPOP00000003827 10141.ENSCPOP00000003827 ENSCPOP00000003827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]