SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000003867 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000003867
Domain Number 1 Region: 483-831
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.3e-112
Family PDEase 0.000000218
Further Details:      
 
Domain Number 2 Region: 236-281,308-457
Classification Level Classification E-value
Superfamily GAF domain-like 1.02e-30
Family GAF domain 0.00081
Further Details:      
 
Domain Number 3 Region: 54-249
Classification Level Classification E-value
Superfamily GAF domain-like 1.93e-30
Family GAF domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000003867   Gene: ENSCPOG00000004287   Transcript: ENSCPOT00000004332
Sequence length 860
Comment pep:known_by_projection scaffold:cavPor3:scaffold_135:1913520:1964450:1 gene:ENSCPOG00000004287 transcript:ENSCPOT00000004332 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EISQEAVEKYLEKNPQFAKEYFYKKLHVEAVGEIFKNSQAVVKSSVSLPELTQVEESALC
LELLWSVQEEGSSAELVAHRALQRLAQLLQADRCSMFVCRSRNGTPEVASRLLDITTTSK
FEDNLVVPDKEVVFPLDIGIVGWVAHTKKALNVPDVKKNNHFSDFMDKQTGYVTRNLLAT
PIVMGKEVLAVVMAINKTNASEFSRQDEEVFSKYLHFVSVVLRLQHTNYLYSVESRRSQI
LMWSANKVFEELTDVERQFHKALYTVRTYLNCERYSIGLLDMTKEKEFYDEWPIKLGEVE
PYKGPKTPDGREIIFYKIIDYILHGKEEIKVIPTPPADHWTLVSGLPTYVAENGFICNML
NAPADEYFTFQKGPVDETGWVIKNVLSLPIVNKKEEIVGVATFYNRKDGKPFDEHDEHIT
ETLTQFLGWSLLNTDTYEKMNKLENRKDIAQEMLMSQTKATADEIKSILKFKEKLNIDVI
EDCEEKQLITILKEDLPDPKAVDLYEFRFSDFPITEHELIKCGLRLFFEINVVEKFKVPV
EVLTRWMYTVRKGYRAVTYHNWRHGFNVGQTMFTLLMTGRLKKYYTDLEAFAMVAAAFCH
DIDHRGTNNLYQMKSTSPLAKLHGTSILERHHLEYSKTLLQDESLNIFQNLSKRQFETVI
HLFEVAIIATDLALYFKKRTMFQKIVDACEQMQTEEAAIKYVTIDPVKKEVIMAMMMTAC
DLSAITKPWEVQSQVALLVANEFWEQGDLERTVLQQQPIPMMDRNKKDELPKLQVGFIDF
VCTFVYKEFSRFHKEITPMLNGLQNNRVEWKSLADEYDAKVKTMEEEVKQQEGADTEGKA
VQDSGDGGGDDKKSKTCLIL
Download sequence
Identical sequences ENSCPOP00000003867 10141.ENSCPOP00000003867 ENSCPOP00000003867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]