SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000003880 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000003880
Domain Number 1 Region: 137-200
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.02e-16
Family Complement control module/SCR domain 0.00021
Further Details:      
 
Domain Number 2 Region: 76-148
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000101
Family Complement control module/SCR domain 0.00067
Further Details:      
 
Domain Number 3 Region: 197-260
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000378
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 4 Region: 446-503
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000167
Family Complement control module/SCR domain 0.00084
Further Details:      
 
Domain Number 5 Region: 15-81
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000944
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 6 Region: 389-448
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000542
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 7 Region: 268-334
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000863
Family Complement control module/SCR domain 0.003
Further Details:      
 
Domain Number 8 Region: 325-390
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000903
Family Complement control module/SCR domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000003880   Gene: ENSCPOG00000004303   Transcript: ENSCPOT00000004348
Sequence length 555
Comment pep:known scaffold:cavPor3:scaffold_12:15811204:15862917:-1 gene:ENSCPOG00000004303 transcript:ENSCPOT00000004348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALVTSLLATVLGRCGPPPVLFFATPAKELNQTEFTTNTVLKYTCRPGYIRIHSDQTLTC
KVNGQWRYEVFCSKKQCRNPGDLPHGTIEVKTDLFLGSKIEFSCSEGFNLVGPTTSVCEI
HDKGVDWSVPFPICEIIKCRSPPDISNGKHSGAVEDLYTYGSSVTYSCDPSYSLLGNPSI
SCTVVNKTVGVWSPSPPVCKKVICRQPIVQYANIISGFGPIYTFKDTIMFSCQKGFVLKG
SSLIRCEADNNWNPSPPVCEPNSCVDIPDIPDAYWDSYRRPRKGELYSPGTVFKYSCHSG
YVPATHESTTVTCQSDFKWSPFRGCKKVCCPAPEVNNGRSMRAADSYSTDCPFSYNNIFQ
YRCDSDRQYYTSTCQADGTWKPRVFCGQACHVPPEIAHGRYRKEGGYLSALSYVYECDDG
YTLVGQNTITCKNSLLSSEAPQCKAQCLKPKIENGKLSVDKPQYIEPENVTIHCDSGFKL
EGSPSITCSEKGTWHPGVPKCEWEVPENCEQVIVGKKLMKCLSNPDEAQMALQLYKLSLE
AELLRLQIVKARQGS
Download sequence
Identical sequences Q99JA1
ENSCPOP00000003880 NP_001166581.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]