SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000003961 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000003961
Domain Number 1 Region: 275-428
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.54e-49
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00000793
Further Details:      
 
Domain Number 2 Region: 431-596
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.22e-44
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000184
Further Details:      
 
Domain Number 3 Region: 148-266
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.24e-34
Family Spermadhesin, CUB domain 0.000019
Further Details:      
 
Domain Number 4 Region: 36-142
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-33
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 
Domain Number 5 Region: 642-794
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.01e-26
Family MAM domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000003961   Gene: ENSCPOG00000004390   Transcript: ENSCPOT00000004438
Sequence length 930
Comment pep:known_by_projection scaffold:cavPor3:scaffold_13:39446273:39550545:1 gene:ENSCPOG00000004390 transcript:ENSCPOT00000004438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLFPLTWVFLALCFSGPEVRGQPDPPCGGRLNSKDAGYITSPGYPQDYPSHQNCEWIVY
APEPNQKIVLNFNPHFEIEKHDCKYDFIEIRDGDSESADLLGKHCGNIAPPTIISSGSVL
YIKFTSDYARQGAGFSLRYEIFKTGSEDCSKNFTSPNGTIESPGFPEKYPHNLDCTFTIL
AKPKMEIILQFLTFDLEHDPLQVGEGDCKYDWLDIWDGIPHVGPLIGKYCGTKTPSELRS
STGILSLTFHTDMAVAKDGFSARYYLVHQEPLENFQCNVPLGMESGRIANEQISASSTYS
DGRWTPQQSRLHGEDNGWTPNLDSNKEYLQVDLHFLTMLTAIATQGAISRETQNGYYVKS
YKLEVSTNGEDWMVYRHGKNHKVFQANSDASEVVFNKLHTPLLTRFVRIRPQSWHAGIAL
RLELFGCRITDAPCSNMLGMLSGLIPDSQISASSTREYLWSPSSARLVSSRSGWFPRIPQ
AQPGEEWLQVDLGAPKMVKGVIIQGARGGDSSTAVEARAFVRKFKVSYSLNGNDWDYIPD
PRTQQPKLFEGNVHYDSPDIRRFDPVPAQYVRVYPERWSPAGIGMRLEVLGCDWTDSKPT
VETLGPTAKNEETTTPYPIDEEATECGENCSFEDDKDLQLPSGFNCNFDFPEEPCGWMYD
HAKWLRSTWTSSSSPSDQTFPDDRNFLRMQSDSRQAGQYGRIISPPVHLPRSPVCLEFQF
QATGGRGVELQVVREASQESKLLWVIREDQGGQWKHGRIILPSYDMEYQIVFEGVIGKGH
SGEIAIDDIRISTDVPLDSCMEPMSAFAGENFKGKKKFLFLFLFFCFAIDDYEVDWSNSS
SPTSEARDPSADKEKSWLYTLDPILITIIAMSSLGVLLGATCAGLLLYCTCSYSGLSSRS
CTTLENYNFELYDGLKHKVKMNHQKCCSEA
Download sequence
Identical sequences ENSCPOP00000003961 10141.ENSCPOP00000003961 ENSCPOP00000003961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]