SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004036 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004036
Domain Number 1 Region: 22-105
Classification Level Classification E-value
Superfamily Snake toxin-like 0.00000000000551
Family Snake venom toxins 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004036   Gene: ENSCPOG00000004473   Transcript: ENSCPOT00000004522
Sequence length 136
Comment pep:novel scaffold:cavPor3:scaffold_95:2007836:2008690:-1 gene:ENSCPOG00000004473 transcript:ENSCPOT00000004522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFVPSSMKVFLPVLLAALLGVEQAHSLMCFSCTNQKSNFYCLWPTICSDSDNYCVTVSTS
GGIGKLVDFGYSLNKGCSPACPGPSVDIGVVNVGTTCCSNSLCNFSAAGGGPQTSALLMS
LGLLLSLLSASLWLAP
Download sequence
Identical sequences A0A286XGT5
ENSCPOP00000004036 ENSCPOP00000004036 10141.ENSCPOP00000004036 XP_003463714.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]