SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004073 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004073
Domain Number 1 Region: 282-395
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.8e-34
Family Spermadhesin, CUB domain 0.0005
Further Details:      
 
Domain Number 2 Region: 126-235
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.55e-34
Family Spermadhesin, CUB domain 0.00044
Further Details:      
 
Domain Number 3 Region: 447-558
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.44e-27
Family Frizzled cysteine-rich domain 0.00032
Further Details:      
 
Domain Number 4 Region: 240-276
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000772
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 5 Region: 399-432
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000157
Family LDL receptor-like module 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004073   Gene: ENSCPOG00000004515   Transcript: ENSCPOT00000004564
Sequence length 561
Comment pep:novel scaffold:cavPor3:scaffold_19:28772538:28776831:1 gene:ENSCPOG00000004515 transcript:ENSCPOT00000004564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDYSDVIRCTEVTEVSKTEFCNPAFEPEAGPPGPPSAFLQDASYSIRAPWHGRHHRRMP
PDCHFSWLCVVAIILARKYLGLLGSYYSILLSPELQAAPPSGTTERPWSTTQQQEAGMSP
PHQAACGGLLPGPRGFFSSPNYPDPYPPNAHCMWHIQVATDHTIQLKIEALSMESVSSCL
FDRLEISPEPDGPLLRVCGKVPPPTLNTNTSRLRVTFVSDSSVEASGFQAWYQAVAPGHG
SCAQDEFPCDQLICLLPESVCDGFANCADGSDEANCSATLSECGGNLTGLQGIFSTPNHL
QQYPQHQLCTWHISVPVGHRIELQFLNFSLDAQEGCKFDYVEVYEIRGSGALSLLGRFCG
AEPPSHLISSSQELAVLFRTDHGFGGGGFSASYRALNATENPCGPRELFCQDGGCSDLQW
MCDWWRDCADGTKDNCSSLLFPPPVLACEPIRVEMCTGLSYNTTAFPNIWVGMATQEEVM
DILRGYKSLTSLPCYQSFRRLLCGLLVPRCTPIGSILPPCRSVCQEAERQCQSGLALLGT
PWPFNCNRLPEAAGLEACAQP
Download sequence
Identical sequences ENSCPOP00000004073 10141.ENSCPOP00000004073 ENSCPOP00000004073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]