SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004089 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004089
Domain Number 1 Region: 556-726
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.05e-52
Family Eukaryotic proteases 0.00015
Further Details:      
 
Domain Number 2 Region: 80-158
Classification Level Classification E-value
Superfamily SEA domain 0.000000000000719
Family SEA domain 0.0074
Further Details:      
 
Domain Number 3 Region: 343-449
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000236
Family Spermadhesin, CUB domain 0.0042
Further Details:      
 
Domain Number 4 Region: 528-567
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000262
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 5 Region: 492-523
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000117
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 6 Region: 240-324
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000968
Family Spermadhesin, CUB domain 0.005
Further Details:      
 
Domain Number 7 Region: 457-490
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000249
Family LDL receptor-like module 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004089   Gene: ENSCPOG00000004538   Transcript: ENSCPOT00000004587
Sequence length 728
Comment pep:known_by_projection scaffold:cavPor3:scaffold_28:21672784:21700399:-1 gene:ENSCPOG00000004538 transcript:ENSCPOT00000004587 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KCQAVSSSALSPLRMPRAEAPQVAGDQGDGEEAEPEGIFKTSKRKARDCMCLAPLWLTLV
VLASVGVMLWYFLGYRTEVTVSQVYAGSLRVLNRHFSEDLARRESSIFRSESAKAQGMLR
ELITSTRLGTHYNSSSVYAFGEGPLTCFFWFVLKIPEHLQPTLSPEMVRVLLVEELLTAA
NASAPVSYVAEYEVDPEGLVILAEASVTDIVALNSTLGCYRYSYVGQGQALRLKGPDYLS
SSCLWHLQGPQEHMLKVRLEWTLAECRDRLAMYDAAGPLEKRLITSVYGCSRQEPVLEVL
ASGAVVAVVWKKGLHSYVDPFALSVQPVAFQACKVNLSLEDRLDAQGALSTPYFPSYYSP
STHCSWHLTVPSLDYGLALWFDAYALRRQKYGLPCTQGQWTIQNRRLCGLRTLQPYAERI
PVVATAGITINFTSQSSLTGPGVRVHYSLYNQSDPCPGEFLCSVNGLCVPACDGIKDCPN
GLDERNCVCRATFQCQEDSTCISMSRVCDRKPDCLNSSDEAQCQEAVPCGTFTFQCEDRS
CVRKPNPQCDGHLDCRDGSDERHCDCGLQGPSSRIVGGAVSSEGEWPWQASLQVRGRHIC
GGALIADRWVITAAHCFQEDSMASPALWTVFLGKVRQNARWAGEVSFKVSRLLLHPYHEE
DSHDYDVALLQLDHPVVRSATVRPVCLPARSHFFEPGQYCWITGWGAQREGGPTSNVLQK
VDVRLVAQ
Download sequence
Identical sequences ENSCPOP00000004089 10141.ENSCPOP00000004089 ENSCPOP00000004089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]