SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004229 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004229
Domain Number 1 Region: 94-218
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.17e-44
Family Ornithine decarboxylase antizyme-like 0.00000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004229   Gene: ENSCPOG00000004697   Transcript: ENSCPOT00000004747
Sequence length 226
Comment pep:known_by_projection scaffold:cavPor3:scaffold_369:297294:299717:1 gene:ENSCPOG00000004697 transcript:ENSCPOT00000004747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKSSLQRILNSHCFAREKEGDKPSATIHASHTMPLLSLHSRGGRSSESSRAPASCCSNP
GPGPRWCDAPHPPLRIPGGRGNGQRDHSLSADSFYSDNRLNVTEELTSNNKTRILNVQSR
LTDAKHITWRAVWSGGSLYIEIPGGPLPEGSKDSFAVLLEFAEEQLHADHVFICFHKNRE
DRAALLRTFSFLGFEIVRPGHPLVPKRPDACFMAYTFERESAGEEE
Download sequence
Identical sequences ENSCPOP00000004229 ENSCPOP00000004229 10141.ENSCPOP00000004229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]