SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004435 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004435
Domain Number 1 Region: 697-912
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.98e-106
Family Thrombospondin C-terminal domain 0.000000101
Further Details:      
 
Domain Number 2 Region: 587-695
Classification Level Classification E-value
Superfamily TSP type-3 repeat 2.35e-26
Family TSP type-3 repeat 0.0000296
Further Details:      
 
Domain Number 3 Region: 214-259
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 2.35e-17
Family Assembly domain of cartilage oligomeric matrix protein 0.00094
Further Details:      
 
Domain Number 4 Region: 519-589
Classification Level Classification E-value
Superfamily TSP type-3 repeat 4.45e-16
Family TSP type-3 repeat 0.00022
Further Details:      
 
Domain Number 5 Region: 39-152
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000103
Family Laminin G-like module 0.01
Further Details:      
 
Domain Number 6 Region: 447-530
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00000000000157
Family TSP type-3 repeat 0.00018
Further Details:      
 
Domain Number 7 Region: 358-400
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000516
Family EGF-type module 0.014
Further Details:      
 
Domain Number 8 Region: 305-344
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000214
Family EGF-type module 0.029
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000004435
Domain Number - Region: 275-317
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00086
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 416-460
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00956
Family EGF-like domain of nidogen-1 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004435   Gene: ENSCPOG00000004926   Transcript: ENSCPOT00000004979
Sequence length 930
Comment pep:known_by_projection scaffold:cavPor3:scaffold_83:3421692:3474911:1 gene:ENSCPOG00000004926 transcript:ENSCPOT00000004979 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAPLLAAAALLLHLALQPWGARAAPQVFDLLPSSSKRLNPSALLPVLRDPALSELYMIA
TFKLQTKSSATIFGLYSSDNSKYFEFTVMGRLNKAILRYLKNDGKLHLVVFNNLQLADGR
RHRILLRLTNLHRGAGSVEFYVDCTQVDSVHNLPKAFSGLSQNPESIELRTFQRKAQDFL
EELKLAVRGSLIQVASLQDCFLQQSEPLAATSTGDFNRQFLGQMTQLNQLLGEVKDLLRQ
QVKETSFLRNTVAECQACGPLSFQSPTPNTLLPRRCDSNPCFRGVRCTDSREGFQCGPCP
EGYTGNGITCSDIDECKYHPCYPGVHCVNLAPGFRCDACPVGFTGSMVQGVGIHFAKSNK
QMCTDVDECQNGVCVPNSICINTLGSYRCGPCKPGYTGDQTRGCKAERNCRNPELNPCSV
HAQCLEERQGDVTCVCGVGWAGDGFVCGRDVDIDSYPDEELLCSARNCKKDNCKYVPNSG
QEDADGDGIGDACDEDADGDGILNEQDNCVLTPNMDQRNSDKDIFGDACDNCRTVLNNDQ
RDTDGDGRGDACDDDMDGDGINNILDNCPKVPNVDQRDKDGDGVGDACDSCPDVNNPNQS
DVDNDLVGDSCDTNQDSDGDGHQDSTDNCPTIINSAQLDGIPDLLAPGPDNCRLVPNPAQ
EDSNRDGVGDICEADFDQDQVIDRIDVCPENAEITLTDFRAYQTVVLDPEGDAQIDPNWV
VLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTQTDDDYAGFIFGYQDSSSFYVV
MWKQTEQTYWQATPFRAVAEPGIQLKAVKSKTGPGEHLRNSLWHTGDTSDQVRLLWKDSR
NVGWKDKVSYRWFLQHRPQVGYIRVQFYEGSELVADSGITIDTTMRGGRLGVFCFSQENI
IWSNLKYRCNDTIPEDFQEFQTQHFDRLES
Download sequence
Identical sequences ENSCPOP00000004435 ENSCPOP00000004435 10141.ENSCPOP00000004435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]