SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004454 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004454
Domain Number 1 Region: 7-36,93-193
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00000000000461
Family N-acetyl transferase, NAT 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004454   Gene: ENSCPOG00000004948   Transcript: ENSCPOT00000005001
Sequence length 206
Comment pep:known_by_projection scaffold:cavPor3:scaffold_70:18715:19767:-1 gene:ENSCPOG00000004948 transcript:ENSCPOT00000005001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPSHLSVREMREDEKPLVLEMLKAGVKDTENRVALHALTRPPALLLLAAASSGLRFVLA
SFALALLLPVFLAVAAVKLGLRARWGSLPPPAGLGGPWVAVRGSGDVCGVLALAPGANSG
DGARVTRLSVSRWHRRRGVGRRLLAFAEARARAWAGGTGEPRARLVVPVAVAAWGAVGLL
EGCGYQAEGGWGCMGYTLVREFSKDL
Download sequence
Identical sequences H0V4B7
XP_003465511.1.53824 XP_005001759.1.53824 XP_013003174.1.53824 XP_013003175.1.53824 ENSCPOP00000020907 ENSCPOP00000004454 10141.ENSCPOP00000004454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]