SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004482 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004482
Domain Number 1 Region: 5-88
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0000000000527
Family Extracellular domain of cell surface receptors 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004482   Gene: ENSCPOG00000004980   Transcript: ENSCPOT00000005034
Sequence length 238
Comment pep:known_by_projection scaffold:cavPor3:scaffold_39:17530800:17531950:-1 gene:ENSCPOG00000004980 transcript:ENSCPOT00000005034 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFSGEIRCYCDAAHCVATGYMCKSELSACFSRLLDPQNTNSPLTHGCLDSLTSTADVCQA
KQAQNHSGSTVPTVECCHEDMCNYRGLHDVLAPAKGEASGQGNRYQQDGSRNLITKVQEL
TSSKELWFRAAVIAVPIAGGLILVLLIMLALRMLRSENKRLQDQRQQMLSRLHYSFHGHH
SKKGQVAKLDLECVVPVSGHENCCLTCDKMRQADLSNDKILSLVHWGMYSGHGKLEFV
Download sequence
Identical sequences ENSCPOP00000004482 10141.ENSCPOP00000004482 ENSCPOP00000004482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]