SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004538 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004538
Domain Number 1 Region: 19-146
Classification Level Classification E-value
Superfamily Lysozyme-like 1.15e-44
Family C-type lysozyme 0.0000361
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004538   Gene: ENSCPOG00000005043   Transcript: ENSCPOT00000005097
Sequence length 148
Comment pep:known_by_projection scaffold:cavPor3:scaffold_32:19218323:19221780:-1 gene:ENSCPOG00000005043 transcript:ENSCPOT00000005097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARALLISLASCLLVVNQAFIVRRCDLAKVLHEEQLDGFEGYSLSDWLCLAFVESNFNIS
KVNENADGSFDYGIFQINSHYWCNDYQSHSENYCHVDCQDLLNPNLLSSISCAKIIVSAS
GGMRNWVRWKLHCADRPHTYWMTGCHLG
Download sequence
Identical sequences H0V4J3
ENSCPOP00000004538 XP_003469719.1.53824 10141.ENSCPOP00000004538 ENSCPOP00000004538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]