SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004617 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004617
Domain Number 1 Region: 56-357
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.06e-104
Family Transglutaminase core 0.0000000547
Further Details:      
 
Domain Number 2 Region: 486-583
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 3.66e-21
Family Transglutaminase, two C-terminal domains 0.00072
Further Details:      
 
Domain Number 3 Region: 2-44
Classification Level Classification E-value
Superfamily E set domains 0.00000029
Family Transglutaminase N-terminal domain 0.023
Further Details:      
 
Domain Number 4 Region: 379-481
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.00000392
Family Transglutaminase, two C-terminal domains 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004617   Gene: ENSCPOG00000005132   Transcript: ENSCPOT00000005187
Sequence length 584
Comment pep:known_by_projection scaffold:cavPor3:scaffold_7:46239751:46251391:1 gene:ENSCPOG00000005132 transcript:ENSCPOT00000005187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVVIAVTSAPNAIVGLYSLELKSGRHLLKPEDSMVYLLFNPWCPGEMGNVGTQGCSHEYV
LSDTGYVYMGSFRQVKEKPWNFGQFEKNVLDCCIFLMTQSYLKTMDMRDPVMVGRNMGAM
INSQNKDGVLVGNWTGEYQGGMAPYLWTGSVPILQRYYSTREPVSFGQCWVFAGVLTTVL
RALGIPARPVTVFDSAHDTEENLTLDVYVNEMGKTVPNKTDDSIWNFHVWTEAWMKRMDL
PPGNDGWQVVDGTPQELSQGLYCCGPSPVAAVRKGNIFMGYDTKFVYSEVNADKLVWLVR
SVDGREKVSLLSVETMSIGKNISTKAAGQDRRSDITHQYKFPEGSAEEREVMDHAFSLLS
FKREHTIPTKENLLELLVQEEPVVMGDPLNFSVTLRRKAATPQTITFSGSFDLQSYTGRQ
LAHLGVVQKTVQVQEAVSSVVLTWEASTYTGSLDAYEDEPVIKGYIMAEVMETNETIATE
VSLFFQYPQLTLELPNTGRMGQALVGTCVFRNSLLIPLTGVRFSVESLGLSSSQSIEHGT
VAPGETVQSQISCTPVRLGLRKVIVKLSSQQVKEVHAEKVVLVT
Download sequence
Identical sequences 10141.ENSCPOP00000004617 ENSCPOP00000004617 ENSCPOP00000004617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]