SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004690 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004690
Domain Number 1 Region: 476-580
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000012
Family Anti-sigma factor antagonist SpoIIaa 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004690   Gene: ENSCPOG00000005217   Transcript: ENSCPOT00000005272
Sequence length 605
Comment pep:known scaffold:cavPor3:scaffold_76:4939970:4954550:1 gene:ENSCPOG00000005217 transcript:ENSCPOT00000005272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSSLKGLGQAWLSSSSMALSACCSVSAWQKRLPVLAWLPRYSLQWLKMDFIAGLSVGLT
VIPQALAYAEVAGLPPQYGLYSAFTGCFVYVFLGTSRDVTLGPTAIMSLLVSFYTFHEPA
YAVLLTFLSGCIQLAMGLLHLGFLLDFISCPVIKGFTSAAAIIIGFGQIKNLLGLHNIPR
QFFLQVYHTFLSVGETRLGDAILGLVCMVLLLVLKLMRDRIPPVHPEMPLCVRLSCGLVW
TTATARNALVVSFAALVAYSFEVTGYQPFILTGEIAKGLPPVRVPPFSVTMANGTVSFTR
MVQDLGAGLAVVPLIGLLESIAVAKAFASQNDYHVDANQELLAIGLTNMLGSFVSSYPIT
GSFGRTAVNAQSGVCTPAGGLVTGALVLLSLDYLTSLFYYIPKAALAAVIIMAVVPLFDT
KIFGMLWRVKRLDLLPLCATFLLCFWEVQYGILAGTLVSTLFLLHFVARPKTQVSEGPVL
ILQLASGLHFPAIETLRDIVLSRALEVTSPRPAVLECSHVCSIDYTVVLGLAGLLEDFRK
QGVSLVFSGLQAPVLHTLLAADLKGFQNFPTLEKAEQYVRQELGMEPYNVCEDSVPEHKV
TLLTA
Download sequence
Identical sequences G3C7W6
ENSCPOP00000004690 10141.ENSCPOP00000004690 ENSCPOP00000004690 NP_001233593.1.53824 XP_013002463.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]