SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004776 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004776
Domain Number 1 Region: 39-379
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.41e-62
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000139
Further Details:      
 
Domain Number 2 Region: 385-501
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 4.64e-44
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00000189
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004776   Gene: ENSCPOG00000005312   Transcript: ENSCPOT00000005369
Sequence length 509
Comment pep:known_by_projection scaffold:cavPor3:scaffold_31:12905617:12932904:-1 gene:ENSCPOG00000005312 transcript:ENSCPOT00000005369 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSWSRVYRSLAKRGHFNRISHGLQGVSAVPLRTYADQSIDADVTVVGSGPGGYVAAIKA
AQLGFKTVCVEKNETLGGTCLNVGCIPSKALLNNSHYYHMAHGKDFASRGIEMSEVRLNL
EKMMEQKTNAVKALTGGIAHLFKQNKVVHVNGFGKITGKNQVTATKADGGTQVIDTKNIL
IATGSEVTPFPGITIDEDTIVSSTGALSLKKVPEKMVVIGAGVIGVELGSVWQRLGADVT
AVEFLGHVGGVGIDMEISKNFQRILQKQGFKFKLNTKVTGATKKSDGKIDVSIEAASGGK
AEVITCDVLLVCIGRRPFTQNLGLEELGIELDPRGRIPVNSRFQTKVPNIYAIGDVVAGP
MLAHKAEDEGIICVEGMAGGAVHIDYNCVPSVIYTHPEVAWVGKSEEQLKEEGIEYKVGK
FPFAANSRAKTNADTDGMVKIIGQKATDRVLGAHILGPGAGEMVNEAALALEYGASCEDI
ARVCHAHPTLSEAFREANLAASFGKAINF
Download sequence
Identical sequences H0V559
ENSCPOP00000004776 XP_003469836.1.53824 ENSCPOP00000004776 10141.ENSCPOP00000004776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]