SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004851 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004851
Domain Number 1 Region: 8-197
Classification Level Classification E-value
Superfamily Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 3.01e-52
Family Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004851   Gene: ENSCPOG00000005390   Transcript: ENSCPOT00000005448
Sequence length 208
Comment pep:known_by_projection scaffold:cavPor3:scaffold_10:45069110:45085340:1 gene:ENSCPOG00000005390 transcript:ENSCPOT00000005448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEQTRVPLVSGFGPFRQHLVNSSWEAVKELFKLGLGPDMQVELRTLQLPVDYREVKQKIV
RIWKDFQPQLAVHVGVDTSAKAIFLEQCGKNCGYRDGDIRGFRPEGGVCLPGGPEVIVSK
ISMKMICKCIAIEDVEVTFSGDAGRYVCDYTYYLSLHHGNGHAALIHVPPLSHWFPASLL
GKALQAIIREMLGASGKVQAQSQGCREP
Download sequence
Identical sequences ENSCPOP00000004851 ENSCPOP00000004851 10141.ENSCPOP00000004851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]