SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004854 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004854
Domain Number 1 Region: 92-183
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 4.14e-28
Family Platelet-derived growth factor-like 0.00000485
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004854   Gene: ENSCPOG00000005394   Transcript: ENSCPOT00000005452
Sequence length 241
Comment pep:known_by_projection scaffold:cavPor3:scaffold_28:23241622:23255374:-1 gene:ENSCPOG00000005394 transcript:ENSCPOT00000005452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRCWALLLSLCCYLRLVSAEGDPIPEELYEMLSDQSIRSFDDLQRLLHGDSVDEDGAEL
DLNVTRAHSGREAGGSSRGRRSLGSLTVAEPAMIAECKTRTEVFQISRNLIDRTNANFLV
WPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRGKPTFKKATVTLEDHLACKC
ETVVSARPVTRSQGGSQEQRARTPQIRTAIRVVRVRRPPKGKHRKFKHTHDKEALKETLG
A
Download sequence
Identical sequences H0V5C6
ENSCPOP00000004854 10141.ENSCPOP00000004854 ENSCPOP00000004854 XP_003470553.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]