SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004885 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004885
Domain Number 1 Region: 588-844
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.34e-86
Family Eukaryotic proteases 0.000000144
Further Details:      
 
Domain Number 2 Region: 167-325
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.17e-36
Family MAM domain 0.008
Further Details:      
 
Domain Number 3 Region: 346-458
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.32e-29
Family Spermadhesin, CUB domain 0.00078
Further Details:      
 
Domain Number 4 Region: 48-157
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.98e-18
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 5 Region: 506-602
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000628
Family Scavenger receptor cysteine-rich (SRCR) domain 0.024
Further Details:      
 
Domain Number 6 Region: 465-502
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000196
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 5-44
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000102
Family LDL receptor-like module 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004885   Gene: ENSCPOG00000005428   Transcript: ENSCPOT00000005486
Sequence length 845
Comment pep:known_by_projection scaffold:cavPor3:scaffold_34:4894941:4984252:1 gene:ENSCPOG00000005428 transcript:ENSCPOT00000005486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GNASIMCQPGLRPCADGLQCVSTDLFCDGEINCPDGSDEDSNICATACDGRFLLTGSSGS
FQASHYPTLSTTPIVCQWIISVNQGLSIELSFESFSINYRDLLNIYEGVGSSKILRASLS
ETDPGTIRIFSNQVTVTFLIESDEIDYIGFNASYSVFNTSGLNNYEKINCNFEDGFCFWA
QDLNADNEWERVQGSTFPPLTGPDFDHTFGNTSGFYISTPTGPGGRSERVGLLSLPLSPS
SNPVCLSFWYYMYGDYVYKLSINISSDETMEKTVFQKEGNYGQQWNYGQVTLNESVEFKV
AFNAFKNPMLSDIALDDINLTYGTCSESLYPEPTLVPTPPPELPTDCGGPFELWEPNTTF
SSPGFPNSYPNQAFCVWILNAQEGKNIQLHFQDFDLENTADVVEIRDGGEDDSLFLKTAV
YTGPGPMKDVFSTTNKMTVLFITDKSMTGRGFKANFTTGYHLGIPEPCKEGEFQCKNGEC
IPLENLCDSHPHCQDGSDEAQCGMSYNGTTTNSGLVQFRIQSIWYVACAENWTTQISNEV
CQLLGLGTENSSTPTFSTVGGPFVKLNTAPNDSLILTPSEQCLQDSLILLQCNHKSCGKR
LVDQEVSPKIVGGTDAKEGAWPWLVGLSYNGKLSCGASLVSSDWVVSAAHCAYGRNLDPS
KWSAFLGMHETSDLTSPHVETRLIDQIVINPHYNKRTKDSDIVMMHLEFKVNYTADYIQP
ICLPEENQVFLPGRNCSIAGWGALYYGGPTSDILQEANVPLQSNQKCQQQMPEYNISQNM
ICAGYEEGGTDSCQGDSGGPLMCQENNRWFLVGVTSFGYQCARPNRPGVYVLVSRFTQWI
QSFLN
Download sequence
Identical sequences ENSCPOP00000004885 10141.ENSCPOP00000004885 ENSCPOP00000004885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]