SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004892 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004892
Domain Number 1 Region: 69-257
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.35e-53
Family Astacin 0.00012
Further Details:      
 
Domain Number 2 Region: 428-593
Classification Level Classification E-value
Superfamily TRAF domain-like 5.4e-35
Family MATH domain 0.0013
Further Details:      
 
Domain Number 3 Region: 266-429
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.32e-28
Family MAM domain 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000004892
Domain Number - Region: 608-648
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000538
Family EGF-type module 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004892   Gene: ENSCPOG00000005436   Transcript: ENSCPOT00000005494
Sequence length 703
Comment pep:known_by_projection scaffold:cavPor3:scaffold_14:31518793:31543513:-1 gene:ENSCPOG00000005436 transcript:ENSCPOT00000005494 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSWILPWSLFFGALLVVSGLPTPENFVKDVDGGTDRDIFDINEDLGLDLFQGDIRLNGA
QGRNSIIGAEYRWPHTIPYVLEDSLEINAKGVILNAFERYRLKTCIDFKPWDGEANYISV
IKDSGCWSYVGNRRTGRQELSIGASCDRIATVQHEFLHALGFWHEQSRSDRDDYVTIVWD
RILTGREHNFNIYDDKQSDSLNVPYDYNSVMHYSKTAFQNGTQPTIVTRISDFEDVIGQR
MDFSDYDLLKLNRLYNCTSSLSFMDSCNFELENICGMTQSSGDSVDWQQVSQAPGGPEND
HSNMGQCQGSGFFMHFDSRSVNVGGTAVLESRILYPKRGFQCLEFYLYNSGSENDQLNIY
VREYAVNDTNGKLTLVEEIKEIPMGSWQLYYVALQVTNKFRVVFEGRRGAGASLGGLSID
DINLSETRCPHHIWHIRNFTQILGSPNTALYSPPFYSPKGYAFQIYLDLRSLTNVGIYFH
LISGANDDHLEWPCPWQQATMTLLDQNPDIRQRMSNQRSLTTDPFMTSDNGNYFWDNPSK
VGKVAFFPNGTQFSRGEGYGTSAFITQERMKSRDFLKGNDVFILLTVEDISHLSSTSPQP
APTSTVLDLCSGFTCENGGICIIQDDKPECRCPSGEDWWYMGERCENRGSRQDTVVIAVS
STVAVFVLMLIVTLVSVYCVRRKYLKGTSSKTENMTVENSHAG
Download sequence
Identical sequences ENSCPOP00000004892 10141.ENSCPOP00000004892 ENSCPOP00000004892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]