SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000004934 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000004934
Domain Number 1 Region: 83-116
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000681
Family LDL receptor-like module 0.0038
Further Details:      
 
Domain Number 2 Region: 166-207
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000641
Family LDL receptor-like module 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000004934
Domain Number - Region: 130-159
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000144
Family LDL receptor-like module 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000004934   Gene: ENSCPOG00000005479   Transcript: ENSCPOT00000005538
Sequence length 209
Comment pep:known_by_projection scaffold:cavPor3:scaffold_88:6007830:6014885:1 gene:ENSCPOG00000005479 transcript:ENSCPOT00000005538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKILPQGCSSDQAAGAAAAGTKARPEGGGGHGPCCSRRGACLSALLLLLLAMLAALVAL
VSSLGLPSRTPGAQVCVTPTNRTGFLCHDQRSCIPASGVCDGLRTCPHGEDEDESLCRDV
PRSLPSFLVARCGDPASWIYSDQKCDGTNNCGDCSDELSPVTECPPCGPGWWRCPSTFFK
YCDCVPRTLCQDGTQHCTDWSDEYSCLRP
Download sequence
Identical sequences XP_013001674.1.53824 ENSCPOP00000004934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]