SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000005039 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000005039
Domain Number 1 Region: 61-169
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-24
Family Spermadhesin, CUB domain 0.00066
Further Details:      
 
Domain Number 2 Region: 256-362
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 1.45e-18
Family Platelet-derived growth factor-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000005039   Gene: ENSCPOG00000005593   Transcript: ENSCPOT00000005653
Sequence length 370
Comment pep:known_by_projection scaffold:cavPor3:scaffold_19:7884403:8102589:-1 gene:ENSCPOG00000005593 transcript:ENSCPOT00000005653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRFIFVYTLICVNFCSYGDTSATPQGSSIRALRNANLRRDESNHLTDLYRRDETIQVTG
NGHLQSPRFPNNYPRNLLLTWRLHSQEKTRIQLLFDHQFGLEEAENDICRYDFVEVEDIS
ETSTIIRGRWCGHKEVPPRIMSRTNKIKITFKSDDYFVAKPGFKIYYSLLEDFQPAAASQ
TNWESVTSSTSGVSFRSPSVTNSALAADALDKTVAEFDTVEDLLKHFNPESWQEDLENLY
LDTAHYRGRSYHDRKSKVDLDKLNEDAKRYSCTPRNYSVNLREELKLSSVVFFPRCLLVQ
RCGGNCGCGIANGKSCTCSSGKTVKKYHEVLKFEPGRFKKRGKAKNMALVDIQLDHHECC
DCICGSRPPR
Download sequence
Identical sequences A0A286Y5S5
XP_003472885.1.53824 ENSCPOP00000005039 ENSCPOP00000005039 10141.ENSCPOP00000005039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]