SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000005111 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000005111
Domain Number 1 Region: 16-81
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 6.24e-16
Family Ovomucoid domain III-like 0.0046
Further Details:      
 
Domain Number 2 Region: 208-253
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000778
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 3 Region: 116-173
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000025
Family Ovomucoid domain III-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000005111   Gene: ENSCPOG00000005669   Transcript: ENSCPOT00000005730
Sequence length 318
Comment pep:novel scaffold:cavPor3:scaffold_27:21656866:21727193:1 gene:ENSCPOG00000005669 transcript:ENSCPOT00000005730 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLAELNVKESDIRVCDESSCKYGGVCKEDGDGLKCACQFQCHTNYIPVCGSNGDTYQNEC
FLRRAACKHQKEITVVARGPCYSDNGSGSGEGEEEGSGAEAHRKHSKCGPCKYKAECDED
AENVGCVCNIDCSGYSFNPVCASDGSSYNNPCFVREASCLKQEQIDIRHLGHCTDTDDSS
LLGKKDDGLQYLPDVKDASDQREDVYIGNHMPCPENLNGFCIHGKCEFIYSTQKASCRCE
SGYTGQHCEKTDFSILYVVPSRQKLTHVLIAAIIGAVQIAIIVAIVMCITRKCPKNNRGR
RQKQNLGHFTSDTSSRMV
Download sequence
Identical sequences ENSCPOP00000005111 10141.ENSCPOP00000005111 ENSCPOP00000005111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]