SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000005118 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000005118
Domain Number 1 Region: 119-180
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000288
Family Complement control module/SCR domain 0.00023
Further Details:      
 
Domain Number 2 Region: 23-78
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000027
Family Complement control module/SCR domain 0.000096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000005118   Gene: ENSCPOG00000005676   Transcript: ENSCPOT00000005737
Sequence length 260
Comment pep:known_by_projection scaffold:cavPor3:scaffold_16:17174578:17183850:1 gene:ENSCPOG00000005676 transcript:ENSCPOT00000005737 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGPLLLMFLLGTSVHFSGCEKDCDQDPPSISYATFKALTYKNGTMVICDCKKGFRRIKNG
SMYLLCKGNSSWANKCQCASTSHNARERVTPQPEEHKGKNTIEVQSQIQPMDTINLPGDC
REPAPWKHEAAKRTYHFKVGQTVHYQCIQGYKAIQRGPAISVCKMTCGEAKWTQPQLTCI
AENELHSSAGQEDSLESTDALPESETSCPITTTESAKEMETSVTVEMPIFPSEYHIAMAG
CIFLLISVLLLSGLTWQWRW
Download sequence
Identical sequences ENSCPOP00000005118 ENSCPOP00000005118 10141.ENSCPOP00000005118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]