SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000005169 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000005169
Domain Number 1 Region: 13-182
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.63e-23
Family N-acetyl transferase, NAT 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000005169   Gene: ENSCPOG00000005731   Transcript: ENSCPOT00000005793
Sequence length 242
Comment pep:known_by_projection scaffold:cavPor3:scaffold_4:23485913:23493581:1 gene:ENSCPOG00000005731 transcript:ENSCPOT00000005793 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEVVPSSALSEVSLRLLCHDDIDTVKHLCSDWFPIEYPDSWYRDITSNKKFFSLAATYR
GAIVGMIVAEIKSRTKIHKEDGDILASNFSVDTQVAYILSLGVVKEFRKHGIGSLLLESL
KDHISTTAQDHCKAIYLHVLTTNNTAINFYENRDFRQHHYLPYYYSIRGVLKDGFTYVLY
INGGHPPWTILDYIQHLGSALANLSPCSIPHRIYRQAHSLLCSFLPWSGISTKGGIEYSR
TM
Download sequence
Identical sequences A0A286XQX8
10141.ENSCPOP00000005169 ENSCPOP00000005169 XP_003477755.1.53824 XP_005007514.1.53824 XP_005007515.1.53824 XP_005007516.1.53824 XP_012997396.1.53824 ENSCPOP00000005169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]