SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000005180 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000005180
Domain Number 1 Region: 88-214,319-417,532-688
Classification Level Classification E-value
Superfamily L domain-like 1.91e-60
Family Ngr ectodomain-like 0.00031
Further Details:      
 
Domain Number 2 Region: 1150-1339
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.79e-44
Family Laminin G-like module 0.0025
Further Details:      
 
Domain Number 3 Region: 744-919
Classification Level Classification E-value
Superfamily L domain-like 1.13e-33
Family Ngr ectodomain-like 0.0012
Further Details:      
 
Domain Number 4 Region: 1005-1048
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000768
Family EGF-type module 0.008
Further Details:      
 
Domain Number 5 Region: 1084-1122
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000768
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 6 Region: 923-963
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000476
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 7 Region: 965-1009
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000839
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 8 Region: 1044-1081
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000064
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000005180
Domain Number - Region: 1379-1414
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000168
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 1335-1375
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000181
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 1425-1455
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000376
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000005180   Gene: ENSCPOG00000005743   Transcript: ENSCPOT00000005805
Sequence length 1533
Comment pep:known_by_projection scaffold:cavPor3:scaffold_1:30741419:30901311:-1 gene:ENSCPOG00000005743 transcript:ENSCPOT00000005805 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALMPGRGSSAGLVRPELWLLLWATAWRLGATACPALCTCTGTTVDCHGTGLQAVPKNIP
RSTERLELNGNNITRIQKNDFAGLKQLRVLQLMENQIGAVERGAFDDMKELERLRLNRNQ
LHMLPELLFQNNQALSRLDLSENALQAIPRKAFRGATDLKNLQLDKNQISCIEEGAFRAL
RGLEVLTLNNNNITTIPVSSFNHMPKLRTFRLHSNHLFCDCHLAWLSQWLRQRPTIGLFT
QCSGPASLRGLNVAEVQKSEFSCSGQGEAGRVPACTLSSGSCPAMCACSNGIVDCRGKGL
TAIPANLPETMTEIRLELNGIKSIPPGAFSPYRKLRRIDLSNNQIAEMAPDAFQGLRSLN
SLVLYGNKITDLPRGVFGGLYTLQLLLLNANKINCIRPDAFQDLQNLSLLSLYDNKIQSL
AKGTFTSLRAIQTLHLAQNPFICDCNLKWLADFLRTNPIETSGARCASPRRLANKRIGQI
KSKKFRCSAKEQYFIPGTEDYQLNSECSSDVACPHKCRCEASMVECSSLKLSKIPERIPQ
STAELRLNNNEISLLEATGMFKKLTHLKKINLSNNKVSEIEDGTFEGAASVSELHLTANQ
LESIRSGMFRGLDGLRTLMLRNNRISCIHNDSFTGLRNVRLLSLYDNHITTISPGAFDTL
QALSTLNLLANPFNCNCQLAWLGDWLRKRKIVTGNPRCQNPDFLRQIPLQDVAFPDFRCE
EGQEEGGCLPHPQCPQMCACLDTVVRCSNKHLRALPKGIPKNVTELYLDGNQFTLVPGQL
STYKYLQLVDLSNNKISSLSNSSFTNMSQLTTLILSYNALQCIPPLAFQGLHSLRLLSLH
GNDVSTLQEGIFADVTSLSHLAIGANPLYCDCHLRWLSNWVKTGYKEPGIARCAGPPDME
GKLLLTTPAKKFECQGPPTLAVQTKCDPCLSIPCQNQGTCHNDPLVVYRCACPSGYKGRH
CEVPLDSCSSNPCGNGGTCQAKEGKDTSFTCSCPIGFEGPTCGVNVDDCAEHACANGGIC
VDGVGNYTCQCPPQFVGRACEQLVDFCSPDLNPCQHKAQCVGTPDGPRCECAPGYTGDNC
SEAQDDCRGHRCQNGAQCVDAVNNYTCLCAKGYSGQLCEIPLRSPAPRNPCEGTECQNGA
NCVDQGSQAVCQCLPGFGGPECEKLLSVNFVDRDTYLQFTDLQNWPRANITLQVSTAEDN
GILLYNGDNDHIAVELYQGHVRVSYDPGSYPSSAIYSAEMINDGQFHTVELVTFDQMVNL
SIDGGSPMTMDNFGKHYTLNSEAPLYVGGMPVDVNSAAFRLWQFLNGTSFHGCIRNLYIN
NELQDFTKTQMKPGVVPGCEPCRKLYCLHGICQPNATPGPVCHCEAGWGGLHCDQPADGP
CHGHKCVHGECVPLDALSYSCQCQEGYSGALCNQAGAVVEPCGGLQCLHGHCQASATKGV
HCVCDPGFSGELCEQESECRGDPVRDFHRVQRGYAICQTTRPLSWVECRGTCPGHGCCQG
LRLKRRKLTFECSDGTSFAEEVEKPTKCGCAPC
Download sequence
Identical sequences ENSCPOP00000005180 10141.ENSCPOP00000005180 ENSCPOP00000005180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]