SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000005182 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000005182
Domain Number 1 Region: 44-213
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 6.8e-71
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.000011
Further Details:      
 
Domain Number 2 Region: 307-464
Classification Level Classification E-value
Superfamily C-terminal domain of adenylylcyclase associated protein 3.14e-63
Family C-terminal domain of adenylylcyclase associated protein 0.0000000489
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000005182   Gene: ENSCPOG00000005746   Transcript: ENSCPOT00000005808
Sequence length 464
Comment pep:known_by_projection scaffold:cavPor3:scaffold_143:2014453:2026269:1 gene:ENSCPOG00000005746 transcript:ENSCPOT00000005808 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADMQNLVERLERAVGRLEAASRPSDTCRGNGYGVDPSQGAAPYVEAFDSLLAGPVAEYL
KISKEIGGDVQKHAEMVHTGLKLERALLAIASQCQQPAGNKLSDLLAPISEQIQEVINFR
EKNRGSKLFNHLSAVSESIQALGWVAMAPAPGPYVKEMNDAAMFYTNRVLKEYKDVDKKH
VDWVKAYLSIWTELQVYIKEFHTTGLAWSKTGPVARELSGLPSGPSAGSVATSSGSDDSA
SRSALFAQINQGESITHALKHVSDDMKTHKNPALKAQSGPVRSGPKPFSAPKPQTSSSPR
PATKKEPALLELEGKKWRVENQENISNLVIENTELKQVAYIFKCVNTTLQIKGKINSIIV
DNCKKLGLVFDDVVGIVEIINSRDVKVQQVMGKVPTISINKTDGCHVYLSKNSLDCEIVS
AKSSEMNVLIPTEGGDFNEFPVPEQFKTLWNGQKLVTTVTEIAG
Download sequence
Identical sequences 10141.ENSCPOP00000005182 ENSCPOP00000005182 ENSCPOP00000005182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]