SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000005288 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000005288
Domain Number 1 Region: 209-345
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-36
Family MAM domain 0.002
Further Details:      
 
Domain Number 2 Region: 1-162
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-31
Family MAM domain 0.0048
Further Details:      
 
Domain Number 3 Region: 170-207
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000707
Family LDL receptor-like module 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000005288   Gene: ENSCPOG00000005861   Transcript: ENSCPOT00000005924
Sequence length 345
Comment pep:novel scaffold:cavPor3:scaffold_91:5884568:5890193:-1 gene:ENSCPOG00000005861 transcript:ENSCPOT00000005924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CDFEASSCSWFEAVSGDDFDWIWSSPSDLGADFEYQAPPTDHTHNSPSGHFMFIMKNSSN
LFQVAKLQSPTFSQTGPGCTLYFWFYNYGLSVGAAKLELHMENSKESTILWRVWYNQGNQ
WSEAAIQLGRLTQPFYLSLDKASLGLYDGVSAIDDIRFENCTLPLPVESCESPDHFWCGH
TKACVEKAQLCDLVDDCGDWTDEADCEPELQCNFENGICNWEQDTEDIFDWTRIQGPTST
INTGPMKDHTLGTAQGHYLYIESSEPQIFQNSAVLLSPILNATDGKDCIFRFYYHMFGKH
IYRLAIYQRVWSNSRGKLLWEIFGNQGNRWMRKLLNISSRQPFQV
Download sequence
Identical sequences 10141.ENSCPOP00000005288 ENSCPOP00000005288 ENSCPOP00000005288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]