SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000005390 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000005390
Domain Number 1 Region: 478-811
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.68e-57
Family GDI-like N domain 0.000000000263
Further Details:      
 
Domain Number 2 Region: 845-890
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000000168
Family GDI-like N domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000005390   Gene: ENSCPOG00000005972   Transcript: ENSCPOT00000006035
Sequence length 903
Comment pep:known_by_projection scaffold:cavPor3:scaffold_148:1517303:1529206:-1 gene:ENSCPOG00000005972 transcript:ENSCPOT00000006035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EAVMAATVALRIRTGTQRTLVPWRMPWPLLLLAAVAVAAAASEQQVPLVLWSSDRDLWAP
AVDTHEGHITSDLQLSSYLDPALELGPRNVLLFLQDKLSIEDFTAYGGVFGNKQDSAFSN
LENALDLAPSSLVLPAVDWYAVSTLTTYLQEKLGASPLHVDLATLRELKLNASLPALLLI
RLPYTASSGLMAPREVLTGNDEVIGQVLSTLKSEDISYTAAFTAVRPSRVTRDVAMVAGG
LGRQLLQKQAVSPVIHPPVSYNDTAPRILFWAQNFSVEFEGRREDLTRRTFGSPELNLTG
SFWNSSLAGLSLTYSGLLGSTVTFRFILANRFYPVSARDWFTMERLEIHSNGSVTTFNAS
QVTGPSIYSFRCEYVSSRSKAGGLLVPTVQPSPWHVTLQDFQIQAFNVTGGQFSYASDCA
GFFSPGIWMGLLTSLFMLFIFTYGLHMILSLKTMDRFDDHKGPTIAMTQMECILSGIMSV
NGKKVLHMDRNPYYGGESSSITPLEELYKRFQLPEGPPESMGRGRDWNVDLIPKFLMANG
QLVKMLLYTEVTRYLDFKVVEGSFVYKGGKIYKVPSTETEALASNLMGMFEKRRFRKFLV
FVANFDENDPKTFEGVDPQTTSMRDVYRKFDLGQDVIDFTGHALALYRTDDYLEQPCLET
INRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPVDDIIMENGKV
VGVKSEGEVARCKQLICDPSYIPDRVRKAGQVIRIICILSHPIKNTNDANSCQIIIPQNQ
VNRKSADIYVCMISYAHNVAAQGKYVAIASTTVETEDPEKEVGPALELLEPIDQKFVAIS
DLYEPIDDGSESQVFCSCSYDATTHFETTCNDIKDIYKRMAGSAFDFENMKRKQNDVFGE
ADQ
Download sequence
Identical sequences ENSCPOP00000005390 10141.ENSCPOP00000005390 ENSCPOP00000005390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]