SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000005543 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000005543
Domain Number 1 Region: 24-122
Classification Level Classification E-value
Superfamily Immunoglobulin 6.79e-24
Family V set domains (antibody variable domain-like) 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000005543   Gene: ENSCPOG00000006146   Transcript: ENSCPOT00000006210
Sequence length 124
Comment pep:known_by_projection scaffold:cavPor3:scaffold_4:8181721:8182844:-1 gene:ENSCPOG00000006146 transcript:ENSCPOT00000006210 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVMACSQCLVLLLMGAFLTVSQPALAQPDALLVFPGQVAQLSCTLIPQHASIADYGVSWY
QQRAGSAPRYLLYYNSEEDFHRPDDIPDRFSAAKDAAHNACILTISPVQPEDDADYYCSV
GYSS
Download sequence
Identical sequences ENSCPOP00000005543 ENSCPOP00000005543 10141.ENSCPOP00000005543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]