SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000005584 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000005584
Domain Number 1 Region: 239-456
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 6.02e-68
Family Fibrinogen C-terminal domain-like 0.00000913
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000005584   Gene: ENSCPOG00000006192   Transcript: ENSCPOT00000006256
Sequence length 459
Comment pep:known_by_projection scaffold:cavPor3:scaffold_2:69065718:69072802:-1 gene:ENSCPOG00000006192 transcript:ENSCPOT00000006256 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYIIKFFLIIVLLVLSSRTDQDNLSFDATTSEPKPRFAMLNDVKTVANGLLQLGYSFRDF
THKTKGQMRDIFQKLNTFDQSFYDLSLQTNEIKEDEEELRRTTSKLRVKNEEVKNMSLEL
NSKLETLLEEKLLLQRRVRYLEEQLTNLLQNQPDIQEHPEVTSLKTFVEQKINWLMRQMI
TTATQYKNHKIGHSSVQKIHIQLRRIGIQELTENSLSSKPRAPRTTRTLQLNATKNAEQE
DVPADCSAIYKRGEHRSGTYAIRPSNSQVFHVHCDVKSGSSWTLIQHRTDGLQNFNETWK
KYKYGFGKLDGEFWLGLEKIYSIAKQSSYILRIELEDWKDNKYHVEYSFHLGSHETNYLL
HLAGATGNGPEVFPEHKDLMFSTWDHKARHLNCSESYSGGWWWHDACDGNNLNGKYNKPR
AKSKTEKRRGIWWRSPNGNLYSIKSTKILIHPKNLESFE
Download sequence
Identical sequences ENSCPOP00000005584 ENSCPOP00000005584 10141.ENSCPOP00000005584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]