SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000005705 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000005705
Domain Number 1 Region: 12-313
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.31e-28
Family FAD/NAD-linked reductases, N-terminal and central domains 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000005705   Gene: ENSCPOG00000006330   Transcript: ENSCPOT00000006395
Sequence length 373
Comment pep:known_by_projection scaffold:cavPor3:scaffold_15:19507540:19515646:-1 gene:ENSCPOG00000006330 transcript:ENSCPOT00000006395 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSQVSVDTGALHVVIVGGGFGGIAAASQLQALNVPFTLVDMKDSFHHNVASLRASVESG
FAKKTFISYSVTFKDNFRQGQVVGIDLKNQTVLLQGGEALPFSHLILATGSTGPFPGKFN
KVCCQQAAIQAYEDMVTQVQRSEFVVVVGGGSAGVEMAAEIKTDYPQKGVTLIHSQVPLA
DKELLPSVRQEVKEILLRKGVHLLLGERVSNLEELPLNEYRDYIKVQTDKGTEVATNLVI
PCIGIKINSSAYRSAFEGRLASNGALRVNEFLQVEGHSNIYAIGDCADLKEPKMAYHAGL
HANVAVANIVNCLKQRPLKIYKPGALTFLLSMGRNDGVGQISGFYVGRLMVRLAKSRDLF
VSTSWKTMRQSPP
Download sequence
Identical sequences A0A286XNI7
ENSCPOP00000005705 XP_003473757.1.53824 XP_013012223.1.53824 ENSCPOP00000005705 10141.ENSCPOP00000005705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]