SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000005766 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000005766
Domain Number 1 Region: 48-351
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 5.49e-26
Family Integrin alpha N-terminal domain 0.018
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000005766
Domain Number - Region: 325-427
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 0.0131
Family Integrin alpha N-terminal domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000005766   Gene: ENSCPOG00000006398   Transcript: ENSCPOT00000006463
Sequence length 613
Comment pep:known_by_projection scaffold:cavPor3:scaffold_33:6263857:6488918:1 gene:ENSCPOG00000006398 transcript:ENSCPOT00000006463 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SCGALRLPSSSWPLAGGLFYGGSPLLGAGPVPRALHNVTAELFGAEAWGTLAAFGDLNSD
KQTDLFVLRERNDLIVFLADQNAPYFKPKVKISFRNYSALITSVVPGDYDGDSQMDVLLT
YFPQNRIKNNLKCLLIYIYSHFIDPNNMTILNRTFQDQPLIMDFNGDLIPDVFGVTNESS
QPQILLGGNLSWHPALSTKRKMRIPHSHAFIDLTEDFTADLFLTTLSASSTFQFEIWENL
DGNFSISDTLQAPQNMLVVGQSAFADFDGDGHMDHLLPGCEDKLCQKSTIYLGKSGSKKW
VPVLQDFSNKGTLWGFVPFVHEEMPTEIPIPITLHIGDYNMDGYPDALAILKNTSGRNLQ
IFKLENLKHVNLSLEDKHFLQTEIWWGLSDCSHLLGLPLAHFFTIYEKGILDIIVLSKGY
TKNDFAIHTLKNNFEADAYFVKVIVLSGLCSNDCPRKITPFGVNQPGPYIMYTTVDANGY
LKNGSAGQLSQSAHLALQLPYNVLGLGRSANFLDHLYVGIPRPPGEKSIRKQEWTAIIPN
SQLIVIPYPHSVPRSWSAKLYLTPSNIVLLTAIALIGVCVFILAIIGILHWQEKKADDRE
KRQEAHRFHFDAM
Download sequence
Identical sequences ENSCPOP00000005766 ENSCPOP00000005766 10141.ENSCPOP00000005766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]