SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000005865 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCPOP00000005865
Domain Number - Region: 134-230
Classification Level Classification E-value
Superfamily Preprotein translocase SecY subunit 0.00144
Family Preprotein translocase SecY subunit 0.044
Further Details:      
 
Domain Number - Region: 21-107
Classification Level Classification E-value
Superfamily ARM repeat 0.0633
Family B56-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000005865   Gene: ENSCPOG00000006513   Transcript: ENSCPOT00000006578
Sequence length 258
Comment pep:known_by_projection scaffold:cavPor3:scaffold_103:3692397:3703300:1 gene:ENSCPOG00000006513 transcript:ENSCPOT00000006578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSDKMYQVPLPLDRDGTLVRLRFTLVALVTVCCPLVAFFFCILWSLLFHFKETTATHCGV
PNYLPSVSSAIGGEVPQRYVWRFCIGLHSAPRFLVAFAYWNHYLGCASPCPGYRLLCRLN
FSLNVIENLALLVLTYVSSSEDFTIHENAFIVFIAASLSHMLLTCVLWRLTKKHTVSQED
RKSYSWKQRLFIINFVAFFSALAVYFRHNMYCEAGVYTIFAILEYTVVLTNMAFHMTAWW
DFGNKELLISSQPEEKRF
Download sequence
Identical sequences ENSCPOP00000005865 10141.ENSCPOP00000005865 ENSCPOP00000005865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]