SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000006129 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000006129
Domain Number 1 Region: 26-476
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 8.63e-98
Family Integrin alpha N-terminal domain 0.00000000000148
Further Details:      
 
Domain Number 2 Region: 769-980
Classification Level Classification E-value
Superfamily Integrin domains 4.29e-45
Family Integrin domains 0.00079
Further Details:      
 
Domain Number 3 Region: 476-628
Classification Level Classification E-value
Superfamily Integrin domains 1.78e-31
Family Integrin domains 0.0001
Further Details:      
 
Domain Number 4 Region: 629-763
Classification Level Classification E-value
Superfamily Integrin domains 8.89e-21
Family Integrin domains 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000006129   Gene: ENSCPOG00000006801   Transcript: ENSCPOT00000006870
Sequence length 1018
Comment pep:known_by_projection scaffold:cavPor3:scaffold_67:9343542:9354443:1 gene:ENSCPOG00000006801 transcript:ENSCPOT00000006870 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARVSCLLHALWLLGPAATPVAWALNLNAAQITFYSGPNNSHFGFSVDFHKDSLGSVAVV
VGAPRARARSQEETGAVFLCPWSAAGGPCSQLFFDLQDETRNASSQTFQVFKARQGLGAS
VTSWNDTVVACAPWQHWNVLERAEEAEKTPVGSCYLAQLRSGSRKEYSPCRANTMSRVYE
DRLFSRDRRYCEAGFSSVITQAGELVLGAPGGYFFIGLLARARIAHIVSSYQPATLLWTV
PNQHFTFDSSDSKFYDSYRGYAVAVGEFNGDLRTPEYVVGAPTWSWTLGAVEILDSHDQT
LLRLHGEQMASYFGHTVAVTDVNGDGRHDLLVGAPLFMDSWADRKLAEVGRVYLFLQPPD
PHLLATPSLLLTGTQLYGRFGSAIAPLGDLNRDGFNDIAVAAPYGGPGGRGQVLVYLGQS
EGLNAHPSQVLDSPFHTGSGFGFSLRGATDIDDNGYPDLVVGAYGASKVVVYRAQPVVMA
TIQLLVKDALNPMEKRCVLPGTRTLVSCFNIKMCVEATGHNIPQKLRLSAELQLDRQKPR
QGRRTLLLESQQADTTLSLDLGSRHGPVCHTATAFLRDEADFRDKLSPIVLSLDVSLPPS
ESTSAPGLVLHGNTHIQEQTRIILDCGEDDLCVPQLLLNATVVGEKNLIGADSCWSCMWP
RPTRARGPYEAELGVLLPSGAHYMRALSDVRGFERLICNQKKENDSRVVLCELGNPMGKD
AQIGITMWVSVEDLEQASQAVSFRLQVRSKNSQNPNSQAVLLQVPVQAEARVELRGNSFP
ASLVVSAEGDKEQGILDTSGPRVEHTYELHNRGPGTARDLRLGVHLPGQSQASDLLYILD
VQAHGGLQCSLEPSPNPSELDWRPTSASVALHRQRERRQAGPAEPVLVSCDSAPCTVVQC
ELQEMVRGQRAMVTMLALLRLPSLRQQGPLVQTVLQSRAWFNVSSLPYAVPALSLPSGEA
VVQTLLLRALEERAVPTWWVLVGALGGLLLLTLLVLAMWKVGFFKRTRPRLDEDEEEE
Download sequence
Identical sequences ENSCPOP00000006129 10141.ENSCPOP00000006129 ENSCPOP00000006129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]