SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000006144 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000006144
Domain Number 1 Region: 384-645
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-50
Family YWTD domain 0.000000000656
Further Details:      
 
Domain Number 2 Region: 267-379,650-696
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000942
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 3 Region: 86-126
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000034
Family LDL receptor-like module 0.00032
Further Details:      
 
Domain Number 4 Region: 129-167
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000236
Family LDL receptor-like module 0.0002
Further Details:      
 
Domain Number 5 Region: 8-46
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000668
Family LDL receptor-like module 0.00019
Further Details:      
 
Domain Number 6 Region: 179-216
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000327
Family LDL receptor-like module 0.00031
Further Details:      
 
Domain Number 7 Region: 49-87
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000236
Family LDL receptor-like module 0.00026
Further Details:      
 
Domain Number 8 Region: 218-256
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000314
Family LDL receptor-like module 0.00018
Further Details:      
 
Domain Number 9 Region: 258-295
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000236
Family LDL receptor-like module 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000006144   Gene: ENSCPOG00000006816   Transcript: ENSCPOT00000006885
Sequence length 840
Comment pep:known_by_projection scaffold:cavPor3:scaffold_226:356439:366318:1 gene:ENSCPOG00000006816 transcript:ENSCPOT00000006885 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SASLTAEAKCAKNEFQCRDGKCISYTWVCDGGAECQDGSDESQETCMAATCKAGDFSCGG
RLSRCIPSSWRCDGQEDCHSGADERGCPPKTCAVDEFRCGDGRCISRQFVCDGEPDCEDG
SDEATCSVTCSPNSFQCNSSACIPELWACDGEPDCKDGSDEWPQHCGDRTTSAPLGPSGP
CSSLEFHCGSGECIHSSWRCDRDPDCKDQSDEEGCAVATCRPDEFQCMDGTCVHGSRQCN
REYDCQDMSDEVGCVNVTLCEGPDKFKCHTGECITLDRVCDGARDCRDWSDEPLKECGTN
ECLDNNGGCSHVCNDLKIGYQCLCPSGFHLVGQWQCEADIDECQQPDTCSQLCVNLEGSY
KCECEDGFHMDASTKTCKAVGSVAYLLFTNRHEVRRMTPDRSEYTSLVSNLKNVVALDAE
VASNRLYWSDVSQRKIYSTQIDRTPGSAHDTVISGDLQAPDGLAVDWIHGNIYWTDSVPG
TVSVADTRGVKRRTLFQKKGSKPRAIVVDPVHGFMYWTDWGTPARIEKGGLNGVDIYSLV
TENIEWPNGITLDLSSSRLYWVDSKLHSISSIDVNGRDRKTILEDEKRLAHPFSLAIFED
KIFWTDIMNEAIFSVNRLTGLDVHLVVENLLSPEDIVLFHNVTQPKGVNWCESTALPNGG
CQYLCLPAPQINPHSPKFTCACPDGMVLAQDMRSCVTEPESVTTPVPPGTRPEVSTTAVR
PKQAGEQPAPTTPRRPESTAGLTTAESVTRSQDVADAAGRGDKPRGVGALTIALPIGLLT
LLCLGAFLVWKNWRLKSINSINFDNPVYQKTTEDEVHICRSQDGYSYPSRQMVSLEDDMA
Download sequence
Identical sequences ENSCPOP00000006144 ENSCPOP00000006144 10141.ENSCPOP00000006144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]