SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000006188 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000006188
Domain Number 1 Region: 2-153
Classification Level Classification E-value
Superfamily Globin-like 1.79e-39
Family Globins 0.00000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000006188   Gene: ENSCPOG00000006864   Transcript: ENSCPOT00000006933
Sequence length 154
Comment pep:known_by_projection scaffold:cavPor3:scaffold_140:2258615:2264853:-1 gene:ENSCPOG00000006864 transcript:ENSCPOT00000006933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLSDGEWQLVLNVWGKVEGDLGGHGQEVLIRLFKAHPETLEKFDKFKHLKGEDEMRASE
DLKKHGNTVLTALGGILKKKGQHAAELAPLAQSHATKHKIPVKYLEFISEAIIQVLQSKH
PGDFGADAQGAMSKALELFRNDIAAKYKELGFQG
Download sequence
Identical sequences H0V8S3
ENSCPOP00000006188 ENSCPOP00000006188 10141.ENSCPOP00000006188 XP_003462368.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]