SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000006276 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000006276
Domain Number 1 Region: 653-899
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.75e-78
Family Eukaryotic proteases 0.0000727
Further Details:      
 
Domain Number 2 Region: 2-112
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.7e-27
Family Frizzled cysteine-rich domain 0.00094
Further Details:      
 
Domain Number 3 Region: 316-439
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 7.85e-21
Family Frizzled cysteine-rich domain 0.00078
Further Details:      
 
Domain Number 4 Region: 519-563
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000563
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 132-169
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 6 Region: 208-243
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000114
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 169-205
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000012
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 8 Region: 445-482
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 9 Region: 242-278
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000406
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 10 Region: 485-517
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000445
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 11 Region: 552-656
Classification Level Classification E-value
Superfamily SRCR-like 0.00000249
Family Scavenger receptor cysteine-rich (SRCR) domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000006276   Gene: ENSCPOG00000006957   Transcript: ENSCPOT00000007026
Sequence length 907
Comment pep:known_by_projection scaffold:cavPor3:scaffold_24:21087657:21242269:-1 gene:ENSCPOG00000006957 transcript:ENSCPOT00000007026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ACVTVTHSQCQMLPYHTTLTSPVSTIVNVETEKFLKFFTYLHRLSCYKYIMLFGCSLAFP
ECIIDGDDRHGLQPCRSFCEAAKEGCEPVLEMVNASWPNFLKCSQFRNQTESSNISRICF
SPQQGNGKQLLCGGGDHFLCTSGICIPRTLQCNGYNDCDDWSDETHCNCTVDLFRCHTGK
CLNYSFVCDGYDDCGDLSDEQNCDCDPTKEHRCGDGRCISVEWVCDGDHDCVDKSDEVNC
SCHSQGLVECGNGQCIPSAFQCDGDEDCRDASDERNCSAPQTPCQEGDQRCLFSSCLDSC
GGSSLCDPDNGLNNCSQCEPITLELCMNLPYNHTKYPNYLGHRTQKEASISWESSLFPAL
VPTFTYVFLIFRGCQSILAKKRGNTLDTCLPFSFRALCEHSKERCESVLGIVGLQWPEDT
DCSQFPEENSDNQTCLMPDEDVEECSPSHFKCHSGGCVLAFRRCDGQADCDDDSDEENCG
CKERDLWECPSNKQCLKHSVICDGFPDCPDNMDEKNCSFCQDDEVECANHKCVSRELWCD
GEADCSDSSDEWNCVTLSKTMNSSALLYVHRSATEHHVCADGWQETLSQLACRQMGLGEP
SLTESIPEEEENQQWLRLRSDWKNVSGTALHRLLVPGQACPSRNKISLLCTKEDCGRRPA
ARMNKRILGGRTSRPGRWPWQCSLQSEPSGHICGCVLIAKKWVLTVAHCFEGRENSAMWK
VVLGINNLDHPSTYTQTRLVKTIILHPRYSRAVVDYDISIVELNEDINETSYVRPICLPS
PGQALEPDTYCYITGWGHMGNKMPFKLQEGEVRIISLEQCQSYFDMKTITTRMICAGYES
GTVDSCMGDSGGPLVCEQPGGQWTLFGLTSWGSICFSKVLGPGVYSNVSYFVGWIEKQIY
IQTFLPR
Download sequence
Identical sequences ENSCPOP00000006276 10141.ENSCPOP00000006276 ENSCPOP00000006276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]