SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000006315 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000006315
Domain Number 1 Region: 95-290
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.52e-59
Family Astacin 0.0000675
Further Details:      
 
Domain Number 2 Region: 411-515
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-36
Family Spermadhesin, CUB domain 0.00022
Further Details:      
 
Domain Number 3 Region: 562-672
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-36
Family Spermadhesin, CUB domain 0.00022
Further Details:      
 
Domain Number 4 Region: 297-406
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.71e-36
Family Spermadhesin, CUB domain 0.00053
Further Details:      
 
Domain Number 5 Region: 855-948
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.27e-25
Family Spermadhesin, CUB domain 0.00054
Further Details:      
 
Domain Number 6 Region: 717-795
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000772
Family Spermadhesin, CUB domain 0.0027
Further Details:      
 
Domain Number 7 Region: 673-716
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000649
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 8 Region: 518-560
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000212
Family EGF-type module 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000006315   Gene: ENSCPOG00000007003   Transcript: ENSCPOT00000007072
Sequence length 959
Comment pep:known_by_projection scaffold:cavPor3:scaffold_1:52723931:52820247:-1 gene:ENSCPOG00000007003 transcript:ENSCPOT00000007072 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVFWGDIALDDEDLNIFQIDRTIDLTQNPFGQLGHTTGGLGDHAIAKKRGALYQLIDRIR
RIGSGLQQNSTVKEKVPQKFSGQNEKNRVPRAATSRTERIWPGGVIPYVIGGNFTGSQRA
MFKQAMRHWEKHTCVTFIERSDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGKNCDKFG
IVVHELGHVIGFWHEHTRPDRDNHVTIIRENIQPGQEYNFLKMEPGEVNSLGERYDFDSI
MHYARNTFSRGMFLDTILPSRDDNGIRPVIGQRTRLSKGDIAQARKLYRCPACGETLQDS
NGNLSSPGFPNGYPSYTHCIWRISVTPGEKIVFNFTTLDLYKSSLCWYDYIEVRDGHWRK
SPLLGRFCGDKVPEVLTSTDSRMWIEFRSSSNWVGKGFAAVYEAICGGEIRKNEGQIQSP
NYPDDYRPMKECVWKITVSEGYHVGVTFQAFEIERHDNCAYDHLEIRDGTSENSPLIGRF
CGYDKPEDIRSTSNTLWMKFVSDGTVNKAGFAANFFKEEDECAKPDRGGCEQRCLNTLGS
YQCACEPGYELGPDRRGCEAACGGLLTKLNGTITSPGWPKEYPPNKNCVWQVVAPTQYRI
SVKFEFFELEGNEVCKYDYVEIWSGLSSESKLHGKFCGAEVPEVITSQFNNMRIEFRSDN
TVSKKGFKAHFFSDKDECSKDNGGCQHECVNTMGSYTCQCRNGFVLHENKHDCKEAECEQ
KIHSPSGHITSPNWPDKYPSRKECTWEISATPGHRIKLVLLTWKLEERDLSKYVNLDTYE
TSVMAFIVCGRFLGQMKGHNSLAGSISLPTAWYSEAGTQMPGFNSEHKHTPECGGRLKAE
PKPRDLYSHAQFGDNNYPGQVDCEWLLVSERGSRLELSFQAFEVEEEADCGYDYVELFDG
LDSTAVGLGRFCGSGPAEEIYSIGDAVLIHFHTDDTINKKGFYVRYKSIRYPESMHTKK
Download sequence
Identical sequences ENSCPOP00000006315 10141.ENSCPOP00000006315 ENSCPOP00000006315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]