SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000006369 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000006369
Domain Number 1 Region: 97-536
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.12e-78
Family Integrin alpha N-terminal domain 0.00000128
Further Details:      
 
Domain Number 2 Region: 866-1104
Classification Level Classification E-value
Superfamily Integrin domains 3.87e-50
Family Integrin domains 0.00099
Further Details:      
 
Domain Number 3 Region: 536-702
Classification Level Classification E-value
Superfamily Integrin domains 7.32e-33
Family Integrin domains 0.0043
Further Details:      
 
Domain Number 4 Region: 703-857
Classification Level Classification E-value
Superfamily Integrin domains 3.82e-23
Family Integrin domains 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000006369   Gene: ENSCPOG00000007059   Transcript: ENSCPOT00000007129
Sequence length 1200
Comment pep:known_by_projection scaffold:cavPor3:scaffold_9:42457727:42478321:1 gene:ENSCPOG00000007059 transcript:ENSCPOT00000007129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAGAGAGKELKREGGGTKGWKTSARPRDLGSTDAPGGQPIHGRATRERDSFLALAETACG
IHPMARSRNYDPWGAPGICSLLGALFAGLLFPRAVAFNLDVMSALRKEGEPGSLFGFSVA
LHRQLQPQPQSWLLVGAPQALALPGQQANRTGGLFACPLSLEVTDCYRVDIDQGADVQKE
SKENQWLGVSVRSQGPGGKIVTCAHRYESRQRVDQILETRDVIGRCFVLSQDLAIRDQLD
GGEWKFCEGRPQSHEQFGFCQQGTAAAFTPDSHYLLFGAPGTYNWKGLLFMTNIDSSDPD
QLVYKTLDPADRLPGPAGDLSLNSYLGFSIDSGKGLVRADELSFVAGAPRANHKGAVVIL
RKDSASRLVPEVVLSGELLTSGFGYSLAVADLNNDGWSDLIVGAPYYFERQEELGGAVYL
YINQGGHWERVSPLRLCGSPDSMFGISLAVLGDLNQDGFPDIAVGAPFDGDGKVFIYHGS
SLGVVIKPSQVLEGEAVGIKSFGYSLSGGLDVDENHYPDLLVGSLTDTVVLFRARPVLHV
SHEVFIAPRVIDLEQPNCAGGHSVCVDLRICFSYTAVPSSYSPIVALDYVLDGDTDRRLR
GQVPRVTFLNHGPDDPKHQASGTVWLKHQHDRVCGDSMFQLQENVKDKLRAIVVTLSYSL
RNPRLRRQAPGQGVPPVAPILNAHQPSTQRAEIHFLKQGCGEDKICQSNLQLVHARFCAR
VSDTEFSPMPMDVDGMTTLFALSGQPVIGLELTVTNLPSDPARPQADGDDAHEAQLLVTL
PDSLHYSGVRALDSGEKPLCLSNENASHVECELGNPMKRGAQITFYLILSTSGITIETTE
LEVELLLTTISEQELHPAFVRARVFIELPLSVTGVAIPQQLFFSGVVRGESAMRSERDVG
SKVKYEVTVSNQGQSLNTLGSAFLNIMWPHEIANGKWLLYPMRVELEGGQGPGQKGLCSP
RPNTLQLDVDNRDRRRRELEQPEQQESYEQQEPSTSWWPVSYAEKKRNITLDCAQGTAKC
VVFSCPLYSFDRAAVLHVWGRLWNSTFLEEYSAVKSLEVIVRANITVKSSIKNLVLRDAS
MVIPVMVYLDPMAVVAKGIPWWVILLAVLAGLLVLALLVLLLWKMGFFKRAKHPEASVPQ
YHAVKIPREDRQQFKEEKTGTILRNNWSSPRREAPDAHPILAADGHPELGPDGHPVPSTA
Download sequence
Identical sequences ENSCPOP00000006369 10141.ENSCPOP00000006369 ENSCPOP00000006369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]