SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000006575 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCPOP00000006575
Domain Number - Region: 190-269
Classification Level Classification E-value
Superfamily Snake toxin-like 0.00128
Family Snake venom toxins 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000006575   Gene: ENSCPOG00000007297   Transcript: ENSCPOT00000007369
Sequence length 270
Comment pep:known_by_projection scaffold:cavPor3:scaffold_19:20537649:20547028:1 gene:ENSCPOG00000007297 transcript:ENSCPOT00000007369 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKLILLMSLYLLGSVRGASGQPDAPLASMDHQSSAQRLSNKHLSPISLSDIDALYETTS
GKNALAEHGSSEHSSNKHIAGEHTVNEHDASEHASSEHISEEETSGGHASGGEPSSDHTS
GEETSGEQRSGVKSGGQQALDEPAPREQSSSTPFPNTSSDEGISSRQHAVSDTGLSDPQQ
ELRSYVKIAGTILNCHTCAYMNDQGKCLRGEGTCTTEKSQQCMLKKIFEGGKLQFMVQGC
ENKCPSMNLISHGTRMQIICCRNTPYCNKV
Download sequence
Identical sequences 10141.ENSCPOP00000006575 ENSCPOP00000006575 ENSCPOP00000006575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]