SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000006600 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000006600
Domain Number 1 Region: 304-370
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.88e-17
Family PHD domain 0.0046
Further Details:      
 
Domain Number 2 Region: 256-317
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000354
Family PHD domain 0.034
Further Details:      
 
Domain Number 3 Region: 193-222
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000013
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000006600   Gene: ENSCPOG00000007322   Transcript: ENSCPOT00000007394
Sequence length 378
Comment pep:known_by_projection scaffold:cavPor3:scaffold_20:16900778:17144309:-1 gene:ENSCPOG00000007322 transcript:ENSCPOT00000007394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATVIHNPLKALGDQFYKEAIEHCRSYNSRLCAERSVRLPFLDSQTGVAQNNCYIWMEKR
HRGPGLAPGQLYTYPARCWRKKRRLHPPEDPKLRLLEIKPEVELPLKKDGFTSESTTLEA
LLRGEGVEKKVDTREEESIQEIQRVLENDENVDEGNEEEDLEEDIPKRKNRTRGRARGSA
GGRRRHDAASQEDHDKPYVCDICGKRYKNRPGLSYHYAHTHLASEEGDEAQDQETRSPPN
HRNENHRPQKGPDGTVIPNNYCDFCLGGSNMNKKSGRPEELVSCADCGRSGHPTCLQFTL
NMTEAVKTYKWQCIECKSCILCGTSENDDQLLFCDDCDRGYHMYCLNPPVAEPPEGSWSC
HLCWELLKEKASAFGCQA
Download sequence
Identical sequences H0V9U4
10141.ENSCPOP00000006600 ENSCPOP00000006600 ENSCPOP00000006600 XP_004837322.1.39548 XP_010643714.1.5607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]