SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000006612 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000006612
Domain Number 1 Region: 260-449
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.19e-39
Family Laminin G-like module 0.0000000132
Further Details:      
 
Domain Number 2 Region: 465-671
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.07e-36
Family Laminin G-like module 0.0000000488
Further Details:      
 
Domain Number 3 Region: 46-102
Classification Level Classification E-value
Superfamily GLA-domain 2.69e-19
Family GLA-domain 0.00058
Further Details:      
 
Domain Number 4 Region: 102-237
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000157
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 5 Region: 237-263
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000862
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000006612   Gene: ENSCPOG00000007335   Transcript: ENSCPOT00000007407
Sequence length 676
Comment pep:known_by_projection scaffold:cavPor3:scaffold_5:14142073:14166739:1 gene:ENSCPOG00000007335 transcript:ENSCPOT00000007407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPPTRPVAALGAAVLRSPPADSPLSTALLLRAREAAQFLRPRQRRANQVFEEAKQGHLE
RECIEELCSQEEAREVFENDPETEYFYPRYQECVKKYGSRYTKHPDFVTCVQNLPDQCTP
NPCDKQGTQVCQDLMGNFFCMCRAGWGGRRCDRDVDECSQQNGGCGQVCLNTPGGFYCAC
HSGYTLSQDDGRICQDIDECADKEACGDARCQNLPGSYTCLCDEGFEYSTQDKACRDVDE
CAQGRCEQTCSNTLGSYTCHCNGRGGLKLSPDMDTCEDILPCVPFSAAKSMKSLYLGRMF
SGAPVIRLRFKRLQPTRLVAEFDFRTFDPEGILFFAGGHLDSTWVVLGLRAGRLELQLRY
NGVGRVTSSGPVINHGLWQTISVEELDRNLVIKVNKDAVMKIAVAGDLFQLDRGLYHLNL
TVGGVPFPAQDLVQPINPRLDGCMRSWSWLNGEDNTIQETVKANTKMQCFSVTEKGSFFP
GSGFAFHSLSYTRTSLNTGTEGTWGVEVVARIRPAADTGVLLALVGGNDTVALSVALVDY
HSTKKLKKQLVVLAVENIALALMEIKVCDGREHVVTVSLKEGEASLEVDGTKSQSELSTT
QLQEQLALLGTHLQGPVLTFIGGLPDVPVTSAPVTAFYHGCMTLEVGGKPLDLDEAMYKH
SDITTHSCPPVEHIAP
Download sequence
Identical sequences ENSCPOP00000006612 ENSCPOP00000006612 10141.ENSCPOP00000006612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]