SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000006644 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000006644
Domain Number 1 Region: 117-291,380-490
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.86e-42
Family FAD-linked reductases, N-terminal domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000006644   Gene: ENSCPOG00000007368   Transcript: ENSCPOT00000007440
Sequence length 567
Comment pep:known_by_projection scaffold:cavPor3:scaffold_51:10810131:10829878:-1 gene:ENSCPOG00000007368 transcript:ENSCPOT00000007440 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWTFLGIATFTYFYKKCGDFVTLAVRELLLCVVVFLSLGLVLSYRSRYRSGGLFGRPQSG
SQAALFSVIGFFWAKSPLGPGKKQQLEARRHRKGIHISETTLVEAATSTSAPSLNDPEII
IVGSGVLGSALAAVLSRDGRKVTVIERDLKEPHRIVGEFMQPGGCCVLKDLGLGDALEGI
DAQCLNGYVLHDRESKSEVHITYPLSENSQVQGGRAFHHGKFVMNLRKAAMAEPNAQFVE
GVVLQLLEEEDAVIGVKYKDKKTGDIKELHAPLTVVADGIFSKFRKNLISTEASVSSHFV
GFLMKNAPQFKPNYAELLLLNPSPVLIYQISPSETRVLVDIRGEKPRNLREYMAEQIYPQ
VPEHLKEPFLEASQNSPLKSMPASFLPSSPVNRRGVVLLGDAYNVRHPLTGGGMTVALKD
IKLWRHLLKGIPDLYDDAAVLQAKKSFYWSRKSSHSFVVNVLAQALYELFSARDDSLHRL
RKACFLYFKLGGRCVAGPVGLLSVLSPNPLVLIGHFFAVAVYAMYFCFKSEPWITKPRAL
FSSVAVIYKACSVIFPLIYSEVKYMVH
Download sequence
Identical sequences ENSCPOP00000006644 10141.ENSCPOP00000006644 ENSCPOP00000006644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]