SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000006751 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000006751
Domain Number 1 Region: 416-527
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.19e-22
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 2 Region: 597-704
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-20
Family Spermadhesin, CUB domain 0.0026
Further Details:      
 
Domain Number 3 Region: 710-775
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000054
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 4 Region: 770-847
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000944
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 5 Region: 356-421
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000264
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 6 Region: 836-896
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000341
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 7 Region: 532-596
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000135
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 8 Region: 240-357
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000183
Family Spermadhesin, CUB domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000006751   Gene: ENSCPOG00000007483   Transcript: ENSCPOT00000007556
Sequence length 994
Comment pep:known_by_projection scaffold:cavPor3:scaffold_32:23478429:23524529:1 gene:ENSCPOG00000007483 transcript:ENSCPOT00000007556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPAALLLLPSLLALLAHGLSSEAPTMGEGQATGIKETDGELTVAPTPEQPERGVHFVTT
APTLKLLNHHPLLEEFLQEGLETGEEGLRPALPFQPDPPTPFTPSPLPRLTNQDSRPVFT
SPTPAMAEEPTQPQSREGRWSVGSELPVLHITAPLPPGPSLAVPTLYPGERPSTTPPSRA
WTPTQEGPGDMGRPWAPEALSQTTGLGMEGTIVTSTASGDDEETTTTTTIITTTITTVQP
PGPCSWNFSGPEGFLDSPQAYSSPSDVGLDCFYYISVYPGYGVEIKVQNISLREGEMVTV
EGLGGPDPLPLANQSFLLRGQVIRSPTHQAALRFQSLPPPAGPGTFHFHYQAYLLSCHFP
RRPAYGDVTVTSLHPGGSAHFHCATGYQLKGARLITCLNATQPFWDSQEPVCIAACGGVI
RNATTGRIVSPGYPGNYSNNLTCHWLLEAPESQRLHLHFEKVSLAEDDDRLIIRNGDNVE
APPVYDSYEVEYLPIEGLLSSGRHFFVELSTDSSGAAAGMALRYEAFQQGHCYEPFVKYG
NFSSSAPSYPVGTTVEFSCDPGYTLEQGSIIIECVDPHDPQWNETEPACRAVCSGEITDS
AGVVLSPNWPEPYGRGQDCIWGVHVEEDKRIMLDVRVLRIGPGDVLTFYDGDDLTARVLG
QYSGPRGHFKLFTSMADVTIQFQSDPGTSVLGYQQGFVIHFFEVPRNDTCPELPEIPNGW
KNPSQPELVHGTVVTYQCYPGYQVVGSSVLMCQWDLSWSEDLPSCQRVTSCHDPGDVEHS
RRLISSPKFPVGATVQYICDQGFVLTGSGILTCHDRQAGSPKWSDRAPKCLLEQLKPCHG
LSTPKNGAQNPEKRLHPAGATVHFSCAPGYVLKGQASIKCVPGHPSHWSDPPPICRAASL
DGFYSGRSLDVAKAPATSRTLDAAHIAAAIFLPLVAMVLLVGGVYLYFSRLQGKSPLQLS
QTHAPPYNRITVESAFDNPTYETGSLSFAGDERI
Download sequence
Identical sequences A0A286XN86
ENSCPOP00000006751 10141.ENSCPOP00000006751 ENSCPOP00000006751 XP_003469758.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]