SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000006780 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000006780
Domain Number 1 Region: 615-796
Classification Level Classification E-value
Superfamily vWA-like 1.53e-53
Family Integrin A (or I) domain 0.00029
Further Details:      
 
Domain Number 2 Region: 422-612
Classification Level Classification E-value
Superfamily vWA-like 1.83e-51
Family Integrin A (or I) domain 0.0011
Further Details:      
 
Domain Number 3 Region: 793-987
Classification Level Classification E-value
Superfamily vWA-like 3.2e-50
Family Integrin A (or I) domain 0.00039
Further Details:      
 
Domain Number 4 Region: 986-1176
Classification Level Classification E-value
Superfamily vWA-like 1.67e-49
Family Integrin A (or I) domain 0.00043
Further Details:      
 
Domain Number 5 Region: 212-406
Classification Level Classification E-value
Superfamily vWA-like 1.44e-44
Family Integrin A (or I) domain 0.0023
Further Details:      
 
Domain Number 6 Region: 17-204
Classification Level Classification E-value
Superfamily vWA-like 3.2e-39
Family Integrin A (or I) domain 0.0015
Further Details:      
 
Domain Number 7 Region: 1183-1371
Classification Level Classification E-value
Superfamily vWA-like 0.000000000000241
Family Integrin A (or I) domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000006780   Gene: ENSCPOG00000007512   Transcript: ENSCPOT00000007585
Sequence length 1471
Comment pep:known_by_projection scaffold:cavPor3:scaffold_8:27822927:27849014:1 gene:ENSCPOG00000007512 transcript:ENSCPOT00000007585 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLIFFLIIICFHVSMNQDSDPEYADVVFLVDSSDHLGTKSFPLVKMFINKVISSLPIEA
SKYRVALAQYSDTLHSEFHLNTFRSRNPMLNHLKKNFGFIGGPLKIGKALQEAHKTYFSA
PTNGRDKTQFPPILVVLASAESEDDVEEASNALRKDGVKIISVGMQEASEENLKAMATSQ
FHFNLRTARDLSTFSQNMTQIIKDVTKHREVTVNDIRVEVCQGPSVADLVFLLDVSVNGS
QENFDYLKAFLEESVSALDIKESCMRVGLVTYSNETKVISSLSVGTNKSEVLQQIQSLSP
QAGQAYTGAAIRKVRKEVFTPQHGSRKNQGVPQIVVLVTHRASEDNVTKAAVNLRRQGVT
IFTMGVDKASTAQLEKIASHPAEQYVSMLGSFTELAAHNVTFLKKLRNQITRTVSVLAER
TESLKSGCVDTEEADIYLLIDGSGSTQVTDFHEVKNFLSEVVGMFNIAPHKVRVGAVQYA
DGWDLEFEINKYSNKHDLGKAIENIRQMGGNTNTGAALNFTLGLLQRAKKERGNKVPCHL
VVLTNGASKDSVLEPAFRLREENIRVYAIGVKEANHTQLREIAGEEKRVYYVHDFDALKD
IRNQVVQEICTEGACKDMKADIMFLVDSSGSIGPENFSKMKMFMKNLVSKSQIGADRVQI
GVVQFSDVNKEEFSLNRFRSQSDISNAIDRMAHIGETTLTGSALTFVSQYFSPAKGARPN
VRKFLILITDGEAQDIVKDPADALRQEGIIIYSVGVFGSNVTQLEEISGKREMVFYVENF
DILKHIEDDLVFGICSPHEECKRIEVLDVVFVIDSSGSIDYDEYNIMKDFMIGLVKKADV
GKNQVRFGAMKYADDPEVLFYLDDLGTKLEVISALQGDQPMGGNTYTAEALAFADHMFTE
ARGSRLHKGVPQVLIVITDGESHDAEKLNATSQALREKGILVLAVGIAGANPVELLAMAG
SSDKYYFVETFGGLKGIFSDVSASVCNTSKVDCDIKNVDLVFLMDGSNSIHPSDFKKMKE
FLASVVQDFDVSLKTVRIGAAQFSDSYRPEFSLGAFAGEKEISFQIENIQQIFGYTHLGA
ALQKVSQYFQPDMGSRINTGTPQVLLVLTDGRSQDEVAQAAEELRHKGVDIYSVGIGDVD
DQQLIQITGTADKKLTVHNFDELKKVKKRIVRHICNSGGESNCFVDVVVGFDISTQLEGQ
TLLTDQPWMGTYLQNLLRAISSLNGVSCEVGTETQVSVAFQVTNAMEKYSPKFEIYSENI
LDSLKDLRVKGPSHLDVNLLSALWDAFQNKSVARGKVALIFSDGLDDDTEKLEQKSDELR
KEGLNALITVALDGAAHSGDLADLLYIEFGKGFEYRTQFSIGMRDLGTQLSKQLINVAER
TCCCLFCKCIGGDGMMGDPGTSGKKGLTGFKGSEGYLGEDGIAGERGAPGPVGEQGTKGC
HGTKGPKVRTAYLSFQGEVGELGVDGLNGEQ
Download sequence
Identical sequences ENSCPOP00000006780 10141.ENSCPOP00000006780 ENSCPOP00000006780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]