SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000006866 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000006866
Domain Number 1 Region: 3122-3298
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.66e-33
Family Laminin G-like module 0.0016
Further Details:      
 
Domain Number 2 Region: 2961-3116
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.35e-27
Family Laminin G-like module 0.0027
Further Details:      
 
Domain Number 3 Region: 2729-2898
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.68e-22
Family Laminin G-like module 0.01
Further Details:      
 
Domain Number 4 Region: 2559-2730
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.36e-19
Family Laminin G-like module 0.0045
Further Details:      
 
Domain Number 5 Region: 2358-2550
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000162
Family Laminin G-like module 0.01
Further Details:      
 
Domain Number 6 Region: 1709-1759
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000123
Family Laminin-type module 0.054
Further Details:      
 
Domain Number 7 Region: 1329-1379
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000307
Family Laminin-type module 0.0085
Further Details:      
 
Domain Number 8 Region: 1239-1287
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000977
Family Laminin-type module 0.0078
Further Details:      
 
Domain Number 9 Region: 1377-1425
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000307
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 10 Region: 335-407
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000307
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 11 Region: 471-518
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000391
Family Laminin-type module 0.026
Further Details:      
 
Domain Number 12 Region: 1657-1706
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000419
Family Laminin-type module 0.0049
Further Details:      
 
Domain Number 13 Region: 516-561
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000558
Family Laminin-type module 0.0095
Further Details:      
 
Domain Number 14 Region: 611-661
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000019
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 15 Region: 277-331
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000921
Family Laminin-type module 0.084
Further Details:      
 
Domain Number 16 Region: 565-608
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000642
Family Laminin-type module 0.0072
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000006866
Domain Number - Region: 405-447
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000181
Family Laminin-type module 0.033
Further Details:      
 
Domain Number - Region: 1619-1659
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000209
Family Laminin-type module 0.046
Further Details:      
 
Domain Number - Region: 85-168
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00034
Family APC10-like 0.048
Further Details:      
 
Domain Number - Region: 1291-1326
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00053
Family Laminin-type module 0.011
Further Details:      
 
Domain Number - Region: 664-705
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0053
Family Laminin-type module 0.024
Further Details:      
 
Domain Number - Region: 1990-2108
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00968
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000006866   Gene: ENSCPOG00000007620   Transcript: ENSCPOT00000007693
Sequence length 3299
Comment pep:known_by_projection scaffold:cavPor3:scaffold_14:38994563:39212304:-1 gene:ENSCPOG00000007620 transcript:ENSCPOT00000007693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGRMAPGRGPRPVLPLLVLLLASPAQAGLFPPYLNLATVARIWATATCGETDPQNPQPE
LYCKLAGGPSAPGSGFGIQGQSCDYCNASNPQKAHPASNAIDGSESWWQSPTLSLGMEYN
QVNLTLDLGQVFQVAYILIKFANSPRPALWVLERSVDFGSTYTPWQYFASSAGLCMQQFG
KEANQAITRDDDVLCVTDYSRVLPLENGEIVVSLINNRPNMKTVSFSDTLREFTRATNIR
LRFLQTNSFFGHFSSSDPTITRRYYYSIKDINIGGRCFCNGHAEVCSTNNPKKRLQCECQ
HNTCGETCNTCCAGFHQKRWQPGTQQQNNECEAACNCHGHSTDCYYDSNVEYQRRSLNKQ
NIREGGGVCINCEHNTAGVNCELCAEGYYRPHGVPVEAPHGCRPCQCDPEHADGCEQGSG
RCHCKPNFRGDHCEECAVGYDNFPFCSRSPNFPVSTTGSEDSDDGNFRKGCDCDLQGVLP
RICDDQGRCLCRLKVEGLRCDTCSAGFYSFPICLPCQCSALGSSRKTCNLVTGQCKCLPW
TTGRRCDRCLSGASDFPHCQDFSSTCNPAGTINETPGHCQCKRHVKGPTCSVCKPLYWNL
ARENPNGCSECGCHEAGTLSGIRECGQANGNCYCKAHVTGDTCDICPNEFFGLEKQNYFG
CKGCQCHLGGSFTSKCFEPFGLCLCLRHVSGDKCQSPEANHYFPDLHHMKYEIEDGTVPD
GKIFRFGFDPLEFPKFSWRGYAQMSDIQKEITIKLDVGKSSLSLFRIILRYINPGTDAVS
GHITVYPSEKKADVVQSKEIIFLPSKQPAFVTIPGNGSVHPFSITPGTWFATIKAQGVLL
DFLVLLPKDYYEASALKVRVTQPCVTVGHPHENCLLYQNLPVTRFTCTPASEAKTFLLGG
IQRPPALKKLSPEHPFMVHLNGDQIELHLWLRITKPGRYVVMLEYATETDRLLVLEVLFR
ALASIGRVNIYSCQYSFLCRSIVTDSRGRIAVYELSADTEMRLMVQGGQFLLYQVCVIPV
QDFSTDYLKPQVHCIASYRLFGNPSVTCTCMAQETPPTALVLNVPTRQLSSSADSVSGFT
LQAPQCQLTLRGILPKPGQYVFIVHFSQASHPSYPAQVSVDGKEQWTGSFQASFCPNLLG
CLDKVVAQGQTEFDSSNREVTVTVKIPQDKSLELVRVLVVPAKNYSDQMLDKTVMDKSSE
FITKCGGNSFYIDPDRVSWFCKGSARSLVAFYHDGALPCGCHPAGSTGQNCSPDGGQCPC
QPNVIGRQCTLCAVGYYGFPHCRPCNCRGYPCEETTGRCQCPPHTMQPQCEACEPHFYNF
HPVAGCESCNCSLMGTHPSMKCDPITGQCSCKFASITGRQCDHCADGYYMFPECQPCDCN
HAGTEPKVCDKETGACFCKENVKGKKCNECQENSFNLESDNPQGCVDCFCFGATNLCKMT
QDCHTEFTDMNGWYLETADGFPIHTKYLWFSSSVATDIQTMSDIHSAYWVAPASYLGDRV
TSYGGYLSYQIKSHGSPEDMVLLERGPTVKLSGYTMTIVCEDHFVPHPDQLYRGQIQLLA
RNFRHAETGAPVVKENMMVLLSQLRKLSIRALYFTKTQRLSLSMVELDVLQDGYGEPASH
VEKCDCPPGYAGDSCQTCAPGYYRDFRGLYTGTCMPCNCHGHSDRCLDLLGTCINCQHNT
AGKHCERCKEGHYGNAAHGSCSVCPCPHTNSFATGCVVNGGRVRCICKPGYTGTQCERCA
AGYFGNPQKFGGSCQPCNCNGNGQLGTCDPLTGDCMNQEPKDSIPAEECDDCDSCVVTLL
NDLVTMSEELRLVKSQLQGLSASSGALEQIRHLETQAKDLRNQLLQYRSTISNHGSKMNG
LEKELNSLNQEFETLQEKVQINSRKAQTLYNNVDRTIQSTKELDMKIKTVIQNVHTLLKQ
ISGTGGGGNNLPSGDFSRELAEAERKLRELRNRSFGKYLREAEAEKTEAQLLLNRIKSWQ
QTHQVENNGLVKNIRDSLNDYEARLHNLRAMIQKAAAQAKQAAGLNHENERVLGTIKRQV
KEMSSLQSEFAKYLSMADSALIQTNSMLELMDKDWKEYEKLAATLNEARQKLNDKVRELS
RSSSHTSLVVDAEKYAQSLQEVAKQLEEIKRNASADELVRRAMDAATAYENILGAIQAAE
DAANKATSASQSALQTVIKEDLPRKAKSLSSDSNKLLNEAKRTQKKLQQEISPALNNLQQ
TLNIMMVQRELIDSNLTSVRVDLRGIQRGDIDGTINGAKSLVRKANDITSEVLDGLSPIQ
TDLERIKENYGSAQSEDFNRALTSANKSVKKLSKKLPDVLSKIESINQQLLPLGNISDNV
DRIRELIQQARDAANKVAVPMRFNGKSGVEVRLPNDLEDLKGYTSLSLFLQRPDLRENGG
TEDMFVMYLGNKDASGDYIGMAVVDGQLTCVYNLGERVAELQVDQIVTESETREAVMDRV
KFQRIYQYARLNYTKEATSAKPKAPQFHYMDSKTSNTLLNLDPENAVFYVGGYPPDFQLP
SRLRFPPYKGCIELDDLNENVVSLYNFKKTFNLNTTEVEPCRRRKEESDKNYFEGTGYAR
VPTQPNAPFPTFGQTIQTTMDRGLLFFAENQDRFISLNIEDGSVMVRYKLDSGPPKEKGI
RGTINNGKDHLILIKIGKTQKLMRINVGDQSIRVEGEIFDFSTYYLGGIPIAIRERFNIS
TPAFRGCMKNLKKTSGVVRLNDTVGVTKKCSEDWQLVRSASFSRGGHLSFTNLGLSSSDP
FQASFGFQTYQPNGVLLNHQTRTSGLQVTLEDGHIELSTREGSSPIFKSPRTYMDGSLHH
VSVISDNSGLLLLVDDQPLRRIQRLPATVNSPQSLRLGGSYFEGCISNVFIQRLSESPEV
LDFASKSTKKDVSVGGCSLNKPPFLMLLKGSTKFNKARTFNINSQPPRLRQPWPSSSPRS
QTQPLPSGESAHLKPGSHPCSFLILTAPETSLSERSEFAVDIRTTSSEGLVFYAGTKKSF
MALYLLKGHLVFALGEEGKKLRLKSKETYNDGKWHTVVFGQDGRRGRLLVDGLRAQEGSL
PGNSTSSPRAQVYLGWSPSGKPKNLPQNSFVGCLKNFQLGLKPLDSPSANFGVSPCLNGS
LEEGIYFSQGGGHVILANSVPLEPGFKLTFSIRPRSLTGLLIHIGSQQGQHLSVYMEAGK
VTASVDSGTGRMSTSLTPKQSLCDGQWHSVAVTMKQHILHLELDKDSSYTAGQLTFPPHS
AQGSLHVGGVPANLKTLNLPVWRSFWGCLKNILVNHNPVPISKALEVQGSVSLSGCPGH
Download sequence
Identical sequences ENSCPOP00000006866 10141.ENSCPOP00000006866 ENSCPOP00000006866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]