SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

  Home > Genomes > Cavia porcellus 76_3 > ENSCPOP00000006925

Domain assignment for ENSCPOP00000006925 from Cavia porcellus 76_3

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:  ENSCPOP00000006925
Domain Number 1 Region: 416-673
Classification Level Classification E-value
Superfamily YWTD domain 9.02e-49
Family YWTD domain 0.000000104
Further Details:      
 
Domain Number 2 Region: 4-41
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000223
Family LDL receptor-like module 0.0007
Further Details:      
 
Domain Number 3 Region: 207-246
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000393
Family LDL receptor-like module 0.00049
Further Details:      
 
Domain Number 4 Region: 122-161
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000038
Family LDL receptor-like module 0.00071
Further Details:      
 
Domain Number 5 Region: 245-285
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000484
Family LDL receptor-like module 0.00049
Further Details:      
 
Domain Number 6 Region: 43-81
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000419
Family LDL receptor-like module 0.00053
Further Details:      
 
Domain Number 7 Region: 160-198
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000524
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 8 Region: 80-122
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000563
Family LDL receptor-like module 0.0002
Further Details:      
 
Domain Number 9 Region: 369-409
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000729
Family EGF-type module 0.0012
Further Details:      
 
Domain Number 10 Region: 291-328
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000406
Family LDL receptor-like module 0.00039
Further Details:      
 
Domain Number 11 Region: 333-376
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000594
Family EGF-type module 0.0031
Further Details:      
 
Domain Number 12 Region: 677-723
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000353
Family EGF-type module 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000006925   Gene: ENSCPOG00000007685   Transcript: ENSCPOT00000007759
Sequence length 846
Comment pep:known_by_projection scaffold:cavPor3:scaffold_21:17204434:17225168:-1 gene:ENSCPOG00000007685 transcript:ENSCPOT00000007759 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence 
GRKTKCEPNQFQCTNGRCITLLWKCDGDEDCVDGSDEKNCVKKTCAESDFVCNNGQCVPN
RWQCDGDPDCEDGSDESPEQCHMRTCRINEISCGARSTQCIPVSWRCDGESDCDSGEDEE
HCGNITCSPDEFTCSSGRCISRNFVCNGQDDCNDGSDELDCAPPTCSAHEFQCSTSSCIP
LSWVCDDDADCADQSDESLEQCGRQPVMHTKCQASEIQCGSGECIHKKWRCDGDPDCKDG
SDEVNCPSRTCRPDQFECEDGSCIHGSRQCNGIRDCVDGSDEVNCKNANQCLGPGKFKCR
SGECIDILKVCNQQQDCRDWSDEPLKECHVNECLVNNGGCSHICKDLVIGYECDCAAGFE
LIDRKTCGDIDECQNPGICSQICINLKGGYKCECSRGYQMDLATGVCKAVGKEPSLIFTN
RRDIRKIGLERKEYIQLVEQLRNTVALDADIAAQKLFWADLSQKAIFSASIDDKVGRHVK
MIDNVYNPAAIAVDWVYKTIYWTDAASKTISVATLDGTKRKFLFNSDLREPASIAVDPLS
GFVYWSDWGEPAKIEKAGMNGFDRRPLVTVDIQWPNGITLDLIKSRLYWLDSKLHMLSSV
DLNGQDRRIVLKSLEFLAHPLALTIFEDRVYWIDGENEAVYGANKFTGSELATLVNNLND
AQDIIIYHELVQPSGKNWCEEDMENGGCEYLCLPAPQINEHSPKYTCSCPNGYNLEENGR
QCQSTATTVAYSESKDTNTTKILPTSGLVPGGINVTTAVPEVSVPPKGTSAAWAILPLLL
LAMAAVGGYLMWRNWQHKNMKSMNFDNPVYLKTTEEDLSIDIGRHSANVGHTYPAISVVS
TDDDLA
Download sequence
Identical sequences ENSCPOP00000006925 ENSCPOP00000006925 10141.ENSCPOP00000006925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]
Please cite: Gough, J., Karplus, K., Hughey, R. and Chothia, C. (2001). "Assignment of Homology to Genome Sequences using a Library of Hidden Markov Models that Represent all Proteins of Known Structure." J. Mol. Biol., 313(4), 903-919.

Please send feedback, comments or questions to superfamily@cs.bris.ac.uk or use the feedback form.

© Copyright 2013 The SUPERFAMILY authors and Julian Gough.